DN617684
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DN617684 vs. ExPASy Swiss-Prot
Match: ARP4_ORYSI (Actin-related protein 4 OS=Oryza sativa subsp. indica GN=ARP4 PE=2 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 5.749e-11 Identity = 29/41 (70.73%), Postives = 34/41 (82.93%), Query Frame = -2 Query: 454 ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 576 ER++SVWIGGSILASL +FQQMW SK EY+E G S + RKC Sbjct: 402 ERRFSVWIGGSILASLGSFQQMWFSKAEYEEHGVSYIQRKC 442
BLAST of DN617684 vs. ExPASy Swiss-Prot
Match: ACTY_DICDI (Centractin OS=Dictyostelium discoideum GN=arpA PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.508e-11 Identity = 27/42 (64.29%), Postives = 36/42 (85.71%), Query Frame = -2 Query: 451 ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 576 ERKYS W+GGSILASLSTF+ +W+++ EY+E G S++HRK F Sbjct: 342 ERKYSAWMGGSILASLSTFKDLWVTRQEYEEDGCSVIHRKIF 383
BLAST of DN617684 vs. ExPASy Swiss-Prot
Match: ACL6A_MOUSE (Actin-like protein 6A OS=Mus musculus GN=Actl6a PE=1 SV=2) HSP 1 Score: 67.0106 bits (162), Expect = 7.508e-11 Identity = 30/41 (73.17%), Postives = 33/41 (80.49%), Query Frame = -2 Query: 454 ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 576 ER++S WIGGSILASL TFQQMWISK EY+E G V RKC Sbjct: 388 ERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428
BLAST of DN617684 vs. ExPASy Swiss-Prot
Match: ACL6A_MACFA (Actin-like protein 6A OS=Macaca fascicularis GN=ACTL6A PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.508e-11 Identity = 30/41 (73.17%), Postives = 33/41 (80.49%), Query Frame = -2 Query: 454 ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 576 ER++S WIGGSILASL TFQQMWISK EY+E G V RKC Sbjct: 388 ERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428
BLAST of DN617684 vs. ExPASy Swiss-Prot
Match: ACL6A_HUMAN (Actin-like protein 6A OS=Homo sapiens GN=ACTL6A PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.508e-11 Identity = 30/41 (73.17%), Postives = 33/41 (80.49%), Query Frame = -2 Query: 454 ERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 576 ER++S WIGGSILASL TFQQMWISK EY+E G V RKC Sbjct: 388 ERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428
BLAST of DN617684 vs. ExPASy Swiss-Prot
Match: ACT_DICVI (Actin (Fragment) OS=Dictyocaulus viviparus PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.806e-11 Identity = 31/32 (96.88%), Postives = 31/32 (96.88%), Query Frame = -2 Query: 451 SILASLSTFQQMWISKGEYDESGPSIVHRKCF 546 SILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 2 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 33 The following BLAST results are available for this feature:
BLAST of DN617684 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 326
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN617684 ID=DN617684; Name=DN617684; organism=Citrus sinensis; type=EST; length=577bpback to top |