DN617342
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN617342 vs. ExPASy Swiss-Prot
Match: PLM2_PLAFA (Plasmepsin-2 OS=Plasmodium falciparum PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 3.880e-11 Identity = 36/84 (42.86%), Postives = 50/84 (59.52%), Query Frame = 1 Query: 235 LGDSDEDILPLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSRYKSRKSNTYTEMGKSCEINYGSG 486 LG S+++I L +F + ++G+ +G Q F+ I DTGS+NLWVPS KC + C Y S KS TY + G E+NY SG Sbjct: 123 LGSSNDNI-ELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKC-TTAGCLTKHLYDSSKSRTYEKDGTKVEMNYVSG 204
BLAST of DN617342 vs. ExPASy Swiss-Prot
Match: CARDE_CYNCA (Cardosin-E (Fragments) OS=Cynara cardunculus PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 5.068e-11 Identity = 31/47 (65.96%), Postives = 36/47 (76.60%), Query Frame = 1 Query: 241 DSDEDILPLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSK 381 DS I+ L N D YFGEIGIG+PPQ ++VI+DTGSS LWVPSSK Sbjct: 1 DSGSAIVALTNDRDTSYFGEIGIGTPPQKYTVIYDTGSSVLWVPSSK 47 The following BLAST results are available for this feature:
BLAST of DN617342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 92
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN617342 ID=DN617342; Name=DN617342; organism=Citrus sinensis; type=EST; length=487bpback to top |