DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_UNCNE (Tubulin beta chain OS=Uncinula necator PE=3 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 5.520e-39
Identity = 72/86 (83.72%), Postives = 82/86 (95.35%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C IPPRGL M+STF+GNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV EYQQYQDA+
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFVGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVHEYQQYQDAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB8B_HUMAN (Tubulin beta-8 chain B OS=Homo sapiens PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 5.520e-39
Identity = 74/87 (85.06%), Postives = 82/87 (94.25%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            W P+NVK++VCDIPPRGL M++TFIGN+ +IQE+F  VSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WFPDNVKTAVCDIPPRGLKMSATFIGNNAAIQELFTCVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_ERYPI (Tubulin beta-2 chain OS=Erysiphe pisi GN=TUB2 PE=2 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 5.520e-39
Identity = 72/86 (83.72%), Postives = 82/86 (95.35%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C IPPRGL M+STF+GNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV EYQQYQDA+
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFVGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVHEYQQYQDAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_ACRCO (Tubulin beta chain OS=Acremonium coenophialum GN=TUB2 PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.415e-39
Identity = 73/85 (85.88%), Postives = 81/85 (95.29%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNN+++++C IPPR L M+STFIGNSTSIQE+F+RV EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Sbjct:  344 WIPNNIQTALCAIPPRDLKMSSTFIGNSTSIQELFKRVGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_COLGR (Tubulin beta-2 chain OS=Colletotrichum graminicola GN=TUB2 PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.415e-39
Identity = 72/85 (84.71%), Postives = 81/85 (95.29%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNNV++++C IPPRGL M+ TF+GNST+IQE+F+RV EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSFTFVGNSTAIQELFKRVGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_MYCGR (Tubulin beta chain OS=Mycosphaerella graminicola GN=TUB1 PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.230e-38
Identity = 71/86 (82.56%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C IPPRGL M+STF+GNSTSIQE+F+RV +QF+AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A+
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFVGNSTSIQELFKRVGDQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_TRIVI (Tubulin beta-2 chain OS=Trichoderma viride GN=tub2 PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.230e-38
Identity = 72/85 (84.71%), Postives = 82/85 (96.47%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNN+++++C IPPRGL M+STFIGNSTSIQE+F+RV EQF+AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A
Sbjct:  344 WIPNNIQTALCAIPPRGLKMSSTFIGNSTSIQELFKRVGEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_TRIVE (Tubulin beta-2 chain OS=Trichoderma virens PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.230e-38
Identity = 72/85 (84.71%), Postives = 82/85 (96.47%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNN+++++C IPPRGL M+STFIGNSTSIQE+F+RV EQF+AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A
Sbjct:  344 WIPNNIQTALCAIPPRGLKMSSTFIGNSTSIQELFKRVGEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_PHANO (Tubulin beta chain OS=Phaeosphaeria nodorum GN=tubA PE=1 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 1.606e-38
Identity = 69/86 (80.23%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C +PPRGL M++TF+GNSTSIQE+F+R+ +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A+
Sbjct:  344 WIPNNVQTALCSVPPRGLKMSATFVGNSTSIQELFKRIGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBBN_GUITH (Tubulin beta chain, nucleomorph OS=Guillardia theta GN=tubB PE=3 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 1.606e-38
Identity = 72/85 (84.71%), Postives = 80/85 (94.12%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIP+N+KSSVCDIPP+G+ M++ FIGNSTSIQE+F+RV EQF AMFRRKAFLHWYTGEGMDEMEFTEAESNM DLVSEYQQYQDA
Sbjct:  344 WIPHNIKSSVCDIPPKGMKMSAAFIGNSTSIQELFKRVGEQFQAMFRRKAFLHWYTGEGMDEMEFTEAESNMQDLVSEYQQYQDA 428          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB_UNCNE5.520e-3983.72Tubulin beta chain OS=Uncinula necator PE=3 SV=1[more]
TBB8B_HUMAN5.520e-3985.06Tubulin beta-8 chain B OS=Homo sapiens PE=1 SV=1[more]
TBB2_ERYPI5.520e-3983.72Tubulin beta-2 chain OS=Erysiphe pisi GN=TUB2 PE=2... [more]
TBB_ACRCO9.415e-3985.88Tubulin beta chain OS=Acremonium coenophialum GN=T... [more]
TBB2_COLGR9.415e-3984.71Tubulin beta-2 chain OS=Colletotrichum graminicola... [more]
TBB_MYCGR1.230e-3882.56Tubulin beta chain OS=Mycosphaerella graminicola G... [more]
TBB2_TRIVI1.230e-3884.71Tubulin beta-2 chain OS=Trichoderma viride GN=tub2... [more]
TBB2_TRIVE1.230e-3884.71Tubulin beta-2 chain OS=Trichoderma virens PE=2 SV... [more]
TBB_PHANO1.606e-3880.23Tubulin beta chain OS=Phaeosphaeria nodorum GN=tub... [more]
TBBN_GUITH1.606e-3884.71Tubulin beta chain, nucleomorph OS=Guillardia thet... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top