CN185917
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO_CAEEL (Enolase OS=Caenorhabditis elegans GN=enol-1 PE=1 SV=3) HSP 1 Score: 67.3958 bits (163), Expect = 2.593e-11 Identity = 32/36 (88.89%), Postives = 33/36 (91.67%), Query Frame = -1 Query: 272 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 379 GAPCRSERLAKYNQLLRIEEELGA+AVYAG FR P Sbjct: 397 GAPCRSERLAKYNQLLRIEEELGADAVYAGHNFRNP 432
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO_NEOFR (Enolase OS=Neocallimastix frontalis PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.546e-11 Identity = 31/36 (86.11%), Postives = 31/36 (86.11%), Query Frame = -1 Query: 272 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 379 GAPCRSERLAKYNQLLRIEEELGA A YAG FR P Sbjct: 400 GAPCRSERLAKYNQLLRIEEELGANATYAGENFRRP 435
BLAST of CN185917 vs. ExPASy Swiss-Prot
Match: ENO_LOLPE (Enolase OS=Loligo pealeii PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.855e-11 Identity = 30/38 (78.95%), Postives = 35/38 (92.11%), Query Frame = -1 Query: 266 GAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVE 379 GAPCRSERLAKYNQ+LRIEEELG +AV+AG KFR P++ Sbjct: 397 GAPCRSERLAKYNQILRIEEELGDKAVFAGKKFRNPLK 434 The following BLAST results are available for this feature:
BLAST of CN185917 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN185917 ID=CN185917; Name=CN185917; organism=Citrus sinensis; type=EST; length=382bpback to top |