CN185909
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: LT01_HORVU (Low temperature-induced protein lt101.1 OS=Hordeum vulgare GN=LT101.1 PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.829e-13 Identity = 33/50 (66.00%), Postives = 43/50 (86.00%), Query Frame = -2 Query: 315 TATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 464 +AT ++++LA+I PP+GVFL++ EFWICLLLTILGYIPGIIYAVY + Sbjct: 3 SATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVL 52
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: ESI3_LOPEL (Salt stress-induced hydrophobic peptide ESI3 OS=Lophopyrum elongatum GN=ESI3 PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.829e-13 Identity = 33/50 (66.00%), Postives = 43/50 (86.00%), Query Frame = -2 Query: 315 TATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 464 +AT ++++LA+I PP+GVFL++ EFWICLLLTILGYIPGIIYAVY + Sbjct: 3 SATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVL 52
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: PMP3_DEBHA (Plasma membrane proteolipid 3 OS=Debaryomyces hansenii GN=PMP3 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 1.712e-11 Identity = 33/53 (62.26%), Postives = 42/53 (79.25%), Query Frame = -2 Query: 309 TCVDI---LLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 458 TC DI ++A+I PPLGVFL+ GC + FWI ++LTILGYIPGII+A+Y I K Sbjct: 4 TCSDIFKIIIAIILPPLGVFLERGCASSFWINIVLTILGYIPGIIHALYVILK 56
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: RC21_ARATH (UPF0057 membrane protein At1g57550 OS=Arabidopsis thaliana GN=At1g57550 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.920e-11 Identity = 26/48 (54.17%), Postives = 39/48 (81.25%), Query Frame = -2 Query: 309 VDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 452 +++L A+ PP+GVFL++G EFW+CLLLT+ +IPG+IYA+Y +TK Sbjct: 5 LEVLCAIFIPPVGVFLRYGLGLEFWVCLLLTLFAFIPGLIYAIYVLTK 52 The following BLAST results are available for this feature:
BLAST of CN185909 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 14
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN185909 ID=CN185909; Name=CN185909; organism=Citrus sinensis; type=EST; length=825bpback to top |