CN189021
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN189021 vs. ExPASy Swiss-Prot
Match: MSRA_CHRVO (Peptide methionine sulfoxide reductase msrA OS=Chromobacterium violaceum GN=msrA PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.030e-11 Identity = 31/72 (43.06%), Postives = 41/72 (56.94%), Query Frame = 2 Query: 521 AQFGAGCFWGVELAFQRVPGVTKTEVGYSQGYLHNPSYEDVCSGTTNHNEVVRVQYDPKECSFDTLLDNVWA 736 A G GCFW +E AF ++ GV + GY G+ +P Y VCSG + H EVV + YDP + TLL +A Sbjct: 4 AILGGGCFWCLEAAFSQLKGVERVVSGYCGGHTDSPDYRQVCSGDSGHVEVVEISYDPALIDYATLLQVFFA 75
BLAST of CN189021 vs. ExPASy Swiss-Prot
Match: MSRAB_NEIGO (Peptide methionine sulfoxide reductase msrA/msrB OS=Neisseria gonorrhoeae GN=msrAB PE=1 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 7.030e-11 Identity = 31/62 (50.00%), Postives = 37/62 (59.68%), Query Frame = 2 Query: 536 GCFWGVELAFQRVPGVTKTEVGYSQGYLHNPSYEDVCSGTTNHNEVVRVQYDPKECSFDTLL 721 GCFWG+E FQR+ GV GY+ G NPSYEDV T H E V+V YD + S D +L Sbjct: 206 GCFWGLEAYFQRIDGVVDAVSGYANGNTENPSYEDVSYRHTGHAETVKVTYDADKLSLDDIL 267
BLAST of CN189021 vs. ExPASy Swiss-Prot
Match: MSRA_NITSB (Peptide methionine sulfoxide reductase msrA OS=Nitratiruptor sp. (strain SB155-2) GN=msrA PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 9.182e-11 Identity = 30/64 (46.88%), Postives = 41/64 (64.06%), Query Frame = 2 Query: 530 GAGCFWGVELAFQRVPGVTKTEVGYSQGYLHNPSYEDVCSGTTNHNEVVRVQYDPKECSFDTLL 721 G GCFW +E FQRV GV + GY+ NP+YE VC+GTT EVV++ +DP +++ LL Sbjct: 8 GGGCFWCLEAIFQRVKGVHRVTSGYAGCRRQNPTYEQVCTGTTKCAEVVKIDFDPHIINYEELL 71
BLAST of CN189021 vs. ExPASy Swiss-Prot
Match: MSRA_ARTAT (Peptide methionine sulfoxide reductase msrA OS=Arthrobacter aurescens (strain TC1) GN=msrA PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 9.182e-11 Identity = 29/69 (42.03%), Postives = 42/69 (60.87%), Query Frame = 2 Query: 530 GAGCFWGVELAFQRVPGVTKTEVGYSQGYLHNPSYEDVCSGTTNHNEVVRVQYDPKECSFDTLLDNVWA 736 G GCFW ++ +Q+ GV+ GY+ G++ NP Y +VCSGTT H EVV V +D + +LD +A Sbjct: 7 GGGCFWCLDAVYQKTRGVSSVVSGYTGGHVRNPDYYEVCSGTTGHAEVVAVTFDETVVPEEVILDMFFA 75
BLAST of CN189021 vs. ExPASy Swiss-Prot
Match: MSRAB_NEIMB (Peptide methionine sulfoxide reductase msrA/msrB OS=Neisseria meningitidis serogroup B GN=msrAB PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 9.182e-11 Identity = 31/62 (50.00%), Postives = 37/62 (59.68%), Query Frame = 2 Query: 536 GCFWGVELAFQRVPGVTKTEVGYSQGYLHNPSYEDVCSGTTNHNEVVRVQYDPKECSFDTLL 721 GCFWG+E FQR+ GV GY+ G NPSYEDV T H E V+V YD + S D +L Sbjct: 206 GCFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDIL 267
BLAST of CN189021 vs. ExPASy Swiss-Prot
Match: MSRAB_NEIMA (Peptide methionine sulfoxide reductase msrA/msrB OS=Neisseria meningitidis serogroup A GN=msrAB PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 9.182e-11 Identity = 31/62 (50.00%), Postives = 37/62 (59.68%), Query Frame = 2 Query: 536 GCFWGVELAFQRVPGVTKTEVGYSQGYLHNPSYEDVCSGTTNHNEVVRVQYDPKECSFDTLL 721 GCFWG+E FQR+ GV GY+ G NPSYEDV T H E V+V YD + S D +L Sbjct: 206 GCFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDIL 267 The following BLAST results are available for this feature:
BLAST of CN189021 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 246
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN189021 ID=CN189021; Name=CN189021; organism=Citrus sinensis; type=EST; length=738bpback to top |