CX300688
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX300688 vs. ExPASy Swiss-Prot
Match: CMC2_CAEEL (Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.614e-11 Identity = 36/100 (36.00%), Postives = 54/100 (54.00%), Query Frame = 2 Query: 50 AGGISGAVAKTATAPIERVKLIIQTQDANPLIKSGKVARYTGIGNCFTRVYQEQGLAAFWRGNFTNVIRYFPTQAFNFAFKDTIKGMFPKYSPKKEFGMF 349 AGG +GAV++T TAP +R+K+ +Q + S K R G+ +C ++ E G+ +FWRGN NVI+ P A F D +K + K +E F Sbjct: 254 AGGAAGAVSRTCTAPFDRIKVYLQ-------VNSSKTNRL-GVMSCLKLLHAEGGIKSFWRGNGINVIKIAPESAIKFMCYDQLKRLIQKKKGNEEISTF 345
BLAST of CX300688 vs. ExPASy Swiss-Prot
Match: EAAC_ARATH (Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.822e-11 Identity = 34/90 (37.78%), Postives = 51/90 (56.67%), Query Frame = 2 Query: 44 FAAGGISGAVAKTATAPIERVKLIIQTQDANPLIKSGKVARYTGIGNCFTRVYQEQGLAAFWRGNFTNVIRYFPTQAFNFAFKDTIKGMF 313 FAAG ++GA AKT TAP++R+KL++QT +S K A G T + +E+G+ +W+GN VIR P A ++ K +F Sbjct: 91 FAAGALAGAAAKTVTAPLDRIKLLMQTHGIRLGQQSAKKA--IGFIEAITLIAKEEGVKGYWKGNLPQVIRVLPYSAVQLLAYESYKNLF 178 The following BLAST results are available for this feature:
BLAST of CX300688 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 42
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX300688 ID=CX300688; Name=CX300688; organism=Citrus sinensis; type=EST; length=377bpback to top |