CK939311
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CK939311 vs. ExPASy Swiss-Prot
Match: RS13_METST (30S ribosomal protein S13P OS=Methanosphaera stadtmanae (strain DSM 3091) GN=rps13p PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.111e-12 Identity = 30/81 (37.04%), Postives = 49/81 (60.49%), Query Frame = 3 Query: 9 NVHGKQRIMCALTSIKGIGRRXANIVCKKADIDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVV 251 +V G I ALT I+GIG+ A +CK D+D + + G + + + V+ NP++F IP+WFLNR+ DY+ G+ ++ Sbjct: 16 DVDGNSTIATALTEIRGIGKAFAIAICKVLDLDQDAQIGYIDDESVKQIEAVLENPQEFGIPEWFLNRRNDYETGETKHLI 96
BLAST of CK939311 vs. ExPASy Swiss-Prot
Match: RS13_METTH (30S ribosomal protein S13P OS=Methanobacterium thermoautotrophicum GN=rps13p PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.327e-11 Identity = 28/81 (34.57%), Postives = 49/81 (60.49%), Query Frame = 3 Query: 9 NVHGKQRIMCALTSIKGIGRRXANIVCKKADIDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVV 251 ++ G + + ALTSIKG+G+ + + A D+N+R G LS E++ L + NP ++ IP W +NR+ DY+ G+ ++ Sbjct: 15 DIDGNKTMENALTSIKGVGKALSRAIIMSAGYDLNQRIGYLSDEEIERLEEAIKNPAKYNIPSWMINRRNDYETGEDKHLI 95
BLAST of CK939311 vs. ExPASy Swiss-Prot
Match: RS13_HYPBU (30S ribosomal protein S13P OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403) GN=rps13p PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.381e-11 Identity = 32/77 (41.56%), Postives = 46/77 (59.74%), Query Frame = 3 Query: 6 TNVHGKQRIMCALTSIKGIGRRXANIVCKKADIDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGK 236 T++ G ++ L +KGIG A +C+ ID NKR G L+ AE++ + +ANP IP W LNR+KDY+ GK Sbjct: 16 TDIPGDLKVPYGLALVKGIGVNLAYALCRLLGIDPNKRIGFLTDAEIEKIEKAMANPLAIGIPVWMLNRRKDYETGK 92 The following BLAST results are available for this feature:
BLAST of CK939311 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 23
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK939311 ID=CK939311; Name=CK939311; organism=Citrus sinensis; type=EST; length=255bpback to top |