CK936534
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_AETCO (Apocytochrome f OS=Aethionema cordifolium GN=petA PE=3 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 1.571e-14 Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFFL SVVLAQIFLVLKKKQFEKVQLSEMNF Sbjct: 281 VLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF 322
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_VITVI (Apocytochrome f OS=Vitis vinifera GN=petA PE=3 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 2.052e-14 Identity = 39/42 (92.86%), Postives = 42/42 (100.00%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLR+QGLLFFL+SV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRIQGLLFFLSSVILAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_NYMAL (Apocytochrome f OS=Nymphaea alba GN=petA PE=3 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 2.052e-14 Identity = 39/42 (92.86%), Postives = 42/42 (100.00%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLR+QGLLFFLASV+LAQIFLVLKKKQFEKVQL+EMNF Sbjct: 281 VLQDPLRIQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 322
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_EUCGG (Apocytochrome f OS=Eucalyptus globulus subsp. globulus GN=petA PE=3 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 2.052e-14 Identity = 40/42 (95.24%), Postives = 41/42 (97.62%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDP RVQGLLFFLASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPFRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_CUCSA (Apocytochrome f OS=Cucumis sativus GN=petA PE=3 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 2.052e-14 Identity = 40/42 (95.24%), Postives = 41/42 (97.62%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFF ASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRVQGLLFFFASVILAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_CERDE (Apocytochrome f OS=Ceratophyllum demersum GN=petA PE=3 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 2.052e-14 Identity = 40/42 (95.24%), Postives = 41/42 (97.62%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFF ASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRVQGLLFFFASVILAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_BUXMI (Apocytochrome f OS=Buxus microphylla GN=petA PE=3 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 2.052e-14 Identity = 40/42 (95.24%), Postives = 41/42 (97.62%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFF ASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRVQGLLFFFASVILAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_SPIOL (Apocytochrome f OS=Spinacia oleracea GN=petA PE=3 SV=3) HSP 1 Score: 79.337 bits (194), Expect = 2.680e-14 Identity = 39/42 (92.86%), Postives = 41/42 (97.62%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLR+QGLLFF ASV+LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRIQGLLFFFASVILAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_SOYBN (Apocytochrome f OS=Glycine max GN=petA PE=3 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 2.680e-14 Identity = 39/42 (92.86%), Postives = 41/42 (97.62%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFF AS++LAQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRVQGLLFFFASIILAQIFLVLKKKQFEKVQLSEMNF 320
BLAST of CK936534 vs. ExPASy Swiss-Prot
Match: CYF_LOTJA (Apocytochrome f OS=Lotus japonicus GN=petA PE=3 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 2.680e-14 Identity = 39/42 (92.86%), Postives = 41/42 (97.62%), Query Frame = 3 Query: 3 VLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF 128 VLQDPLRVQGLLFFLAS++ AQIFLVLKKKQFEKVQLSEMNF Sbjct: 279 VLQDPLRVQGLLFFLASIIFAQIFLVLKKKQFEKVQLSEMNF 320 The following BLAST results are available for this feature:
BLAST of CK936534 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 98
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK936534 ID=CK936534; Name=CK936534; organism=Citrus sinensis; type=EST; length=801bpback to top |