FC871928
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC871928 vs. ExPASy Swiss-Prot
Match: RPN11_ENCCU (26S proteasome regulatory subunit RPN11 OS=Encephalitozoon cuniculi GN=RPN11 PE=1 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 1.896e-14 Identity = 42/66 (63.64%), Postives = 49/66 (74.24%), Query Frame = 3 Query: 81 THQSFEALNQRAVAVVVDPIQSVKSNVVIDAFRLINPQTMMLVQ*PRHTTSNLGHLNKPSIQSFIH 278 T QSFE L +RAVAVVVDPIQSVK VVIDAFRLI+ Q +L PR TSN+G+L P++ S IH Sbjct: 119 TQQSFEKLCKRAVAVVVDPIQSVKGKVVIDAFRLIDNQLGVLGGEPRQVTSNIGYLKTPTLISIIH 184
BLAST of FC871928 vs. ExPASy Swiss-Prot
Match: PSDE_DICDI (26S proteasome non-ATPase regulatory subunit 14 OS=Dictyostelium discoideum GN=psmD14 PE=3 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 1.605e-13 Identity = 41/66 (62.12%), Postives = 44/66 (66.67%), Query Frame = 3 Query: 81 THQSFEALNQRAVAVVVDPIQSVKSNVVIDAFRLINPQTMMLVQ*PRHTTSNLGHLNKPSIQSFIH 278 T QSFE L RAVAVVVDP+QSV+ VVIDAFR I PR TSNLGHL PSIQ+ IH Sbjct: 129 TQQSFEQLQSRAVAVVVDPLQSVRGKVVIDAFRTIKTSP---TAEPRQITSNLGHLQDPSIQALIH 191 The following BLAST results are available for this feature:
BLAST of FC871928 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC871928 ID=FC871928; Name=FC871928; organism=Citrus sinensis; type=EST; length=278bpback to top |