EY665328
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY665328 vs. ExPASy Swiss-Prot
Match: AQP_CICVR (Aquaporin AQPcic OS=Cicadella viridis GN=AQP PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 9.354e-11 Identity = 30/69 (43.48%), Postives = 43/69 (62.32%), Query Frame = 2 Query: 23 APLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRA 229 AP+ +G A+ HLA I TG+ +NPARSFG AV N + W + W++W GP +G VA ++ + RA Sbjct: 177 APVAVGLAITCCHLAAIKYTGSSMNPARSFGPAV--NGDDNWANHWVYWAGPIVGGVVAGITYRALFRA 243
BLAST of EY665328 vs. ExPASy Swiss-Prot
Match: AQP4_NOTAL (Aquaporin-4 OS=Notomys alexis GN=AQP4 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 9.354e-11 Identity = 32/64 (50.00%), Postives = 42/64 (65.62%), Query Frame = 2 Query: 29 LPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYI 220 L IGF+V + HL I TG +NPARSFG AVI W++ WI+WVGP IGA +A ++Y+ Sbjct: 194 LAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGN---WENHWIYWVGPIIGAVLAGALYEYV 254 The following BLAST results are available for this feature:
BLAST of EY665328 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 52
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY665328 ID=EY665328; Name=EY665328; organism=Citrus sinensis; type=EST; length=1277bpback to top |