CV884740
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CV884740 vs. ExPASy Swiss-Prot
Match: FADH_YEAST (S-(hydroxymethyl)glutathione dehydrogenase OS=Saccharomyces cerevisiae GN=SFA1 PE=1 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 8.965e-11 Identity = 29/60 (48.33%), Postives = 40/60 (66.67%), Query Frame = -1 Query: 313 TAFGGFKSRSQVPWLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGGDCLRCVLKMQD 492 +AFGG K RS++ L+ Y K +KV+E++TH EIN+AF +H GDCLR VLK + Sbjct: 325 SAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQAFEDLHNGDCLRTVLKSDE 384
BLAST of CV884740 vs. ExPASy Swiss-Prot
Match: ADH2_SOLLC (Alcohol dehydrogenase 2 OS=Solanum lycopersicum GN=ADH2 PE=2 SV=2) HSP 1 Score: 66.2402 bits (160), Expect = 8.965e-11 Identity = 27/60 (45.00%), Postives = 43/60 (71.67%), Query Frame = -1 Query: 313 TAFGGFKSRSQVPWLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGGDCLRCVLKMQD 492 T FG +K RS +P +V+KYM KE+++++++TH + EIN+AF M G+ LRC++ M D Sbjct: 321 TFFGNYKPRSDIPCVVEKYMNKELELEKFITHTLPFAEINKAFDLMLKGEGLRCIITMAD 380
BLAST of CV884740 vs. ExPASy Swiss-Prot
Match: ADH1_PEA (Alcohol dehydrogenase 1 OS=Pisum sativum PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 8.965e-11 Identity = 25/60 (41.67%), Postives = 46/60 (76.67%), Query Frame = -1 Query: 313 TAFGGFKSRSQVPWLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGGDCLRCVLKMQD 492 T +G +K R+ +P +V+KYMK E+++++++TH + EIN+AF YM G+ +RC++KM++ Sbjct: 321 TFYGNYKPRTDLPNVVEKYMKGELELEKFITHTVPFSEINKAFDYMLKGESIRCIIKMEE 380 The following BLAST results are available for this feature:
BLAST of CV884740 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 33
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CV884740 ID=CV884740; Name=CV884740; organism=Citrus sinensis; type=EST; length=492bpback to top |