CX043454
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX043454 vs. ExPASy Swiss-Prot
Match: GSA_STRM5 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Stenotrophomonas maltophilia (strain R551-3) GN=hemL PE=3 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.647e-15 Identity = 33/56 (58.93%), Postives = 44/56 (78.57%), Query Frame = 1 Query: 211 SEEAFNVT*ELMPGGVNSPVRAFKSVGGQPIVFESVEGSHMWDIDGNEYIDYLGSW 378 S F+ +L+PGGVNSPVRAFKSVGG+P E +G++++D+DGN YIDY+GSW Sbjct: 6 SHALFSRAQQLLPGGVNSPVRAFKSVGGEPFFVERADGAYLYDVDGNRYIDYVGSW 61
BLAST of CX043454 vs. ExPASy Swiss-Prot
Match: GSA_HELMI (Glutamate-1-semialdehyde 2,1-aminomutase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=hemL PE=3 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 1.129e-14 Identity = 33/56 (58.93%), Postives = 44/56 (78.57%), Query Frame = 1 Query: 211 SEEAFNVT*ELMPGGVNSPVRAFKSVGGQPIVFESVEGSHMWDIDGNEYIDYLGSW 378 SE+ F L+PGGVNSPVRAFKSVG P+ E EG++++D+DGN+Y+DY+GSW Sbjct: 8 SEQLFAEAKTLIPGGVNSPVRAFKSVGRNPVFIERAEGAYLYDVDGNKYVDYVGSW 63
BLAST of CX043454 vs. ExPASy Swiss-Prot
Match: GSA_CHLL2 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hemL PE=3 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.475e-14 Identity = 35/59 (59.32%), Postives = 43/59 (72.88%), Query Frame = 1 Query: 202 LKNSEEAFNVT*ELMPGGVNSPVRAFKSVGGQPIVFESVEGSHMWDIDGNEYIDYLGSW 378 L S E F + + +PGGVNSPVRAFKSVGG PI EG++M D+DGN Y+DY+GSW Sbjct: 4 LTKSAELFELAKKFIPGGVNSPVRAFKSVGGTPIYMAKGEGAYMTDVDGNTYLDYVGSW 62
BLAST of CX043454 vs. ExPASy Swiss-Prot
Match: GSA_CHLAD (Glutamate-1-semialdehyde 2,1-aminomutase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=hemL PE=3 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 1.926e-14 Identity = 33/56 (58.93%), Postives = 42/56 (75.00%), Query Frame = 1 Query: 211 SEEAFNVT*ELMPGGVNSPVRAFKSVGGQPIVFESVEGSHMWDIDGNEYIDYLGSW 378 S+ F ++PGGVNSPVRAF+ VGG PI FE +G+H+WD+DGN YIDY+ SW Sbjct: 11 SQANFAAAQAVIPGGVNSPVRAFRGVGGSPIFFERGQGAHIWDVDGNRYIDYVLSW 66
BLAST of CX043454 vs. ExPASy Swiss-Prot
Match: GSA2_EXISA (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hemL2 PE=3 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 1.926e-14 Identity = 38/56 (67.86%), Postives = 43/56 (76.79%), Query Frame = 1 Query: 211 SEEAFNVT*ELMPGGVNSPVRAFKSVGGQPIVFESVEGSHMWDIDGNEYIDYLGSW 378 S+EAF LMPGGVNSPVRA+KSVG PI E EGS ++DIDGNEYIDY+ SW Sbjct: 8 SQEAFEQARPLMPGGVNSPVRAYKSVGMTPIFAERGEGSRVYDIDGNEYIDYVLSW 63
BLAST of CX043454 vs. ExPASy Swiss-Prot
Match: GSA_DESRM (Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfotomaculum reducens (strain MI-1) GN=hemL PE=3 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 2.516e-14 Identity = 35/58 (60.34%), Postives = 40/58 (68.97%), Query Frame = 1 Query: 205 KNSEEAFNVT*ELMPGGVNSPVRAFKSVGGQPIVFESVEGSHMWDIDGNEYIDYLGSW 378 + SEE F ++PGGVNSPVRAFKSVG P GS MWD+DGNEYIDY+ SW Sbjct: 6 QKSEEMFEQAQRIIPGGVNSPVRAFKSVGMNPPFIARANGSRMWDVDGNEYIDYICSW 63
BLAST of CX043454 vs. ExPASy Swiss-Prot
Match: GSA2_BREBN (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hemL2 PE=3 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 2.516e-14 Identity = 34/58 (58.62%), Postives = 42/58 (72.41%), Query Frame = 1 Query: 205 KNSEEAFNVT*ELMPGGVNSPVRAFKSVGGQPIVFESVEGSHMWDIDGNEYIDYLGSW 378 + S + F +PGGVNSPVRAFKSVGG P+ E EGS ++D+DGN YIDY+GSW Sbjct: 4 EKSTQLFAEAQHYIPGGVNSPVRAFKSVGGNPVYIEKGEGSRIFDVDGNSYIDYIGSW 61
BLAST of CX043454 vs. ExPASy Swiss-Prot
Match: GSA_XANCP (Glutamate-1-semialdehyde 2,1-aminomutase OS=Xanthomonas campestris pv. campestris GN=hemL PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.286e-14 Identity = 33/56 (58.93%), Postives = 42/56 (75.00%), Query Frame = 1 Query: 211 SEEAFNVT*ELMPGGVNSPVRAFKSVGGQPIVFESVEGSHMWDIDGNEYIDYLGSW 378 S F+ LMPGGVNSPVRAFKSVGG+P +G++++D+DGN YIDY+GSW Sbjct: 6 SHALFSQAQNLMPGGVNSPVRAFKSVGGEPFFVARADGAYLFDVDGNRYIDYVGSW 61
BLAST of CX043454 vs. ExPASy Swiss-Prot
Match: GSA_XANCB (Glutamate-1-semialdehyde 2,1-aminomutase OS=Xanthomonas campestris pv. campestris (strain B100) GN=hemL PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.286e-14 Identity = 33/56 (58.93%), Postives = 42/56 (75.00%), Query Frame = 1 Query: 211 SEEAFNVT*ELMPGGVNSPVRAFKSVGGQPIVFESVEGSHMWDIDGNEYIDYLGSW 378 S F+ LMPGGVNSPVRAFKSVGG+P +G++++D+DGN YIDY+GSW Sbjct: 6 SHALFSQAQNLMPGGVNSPVRAFKSVGGEPFFVARADGAYLFDVDGNRYIDYVGSW 61
BLAST of CX043454 vs. ExPASy Swiss-Prot
Match: GSA_XANC8 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=hemL PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.286e-14 Identity = 33/56 (58.93%), Postives = 42/56 (75.00%), Query Frame = 1 Query: 211 SEEAFNVT*ELMPGGVNSPVRAFKSVGGQPIVFESVEGSHMWDIDGNEYIDYLGSW 378 S F+ LMPGGVNSPVRAFKSVGG+P +G++++D+DGN YIDY+GSW Sbjct: 6 SHALFSQAQNLMPGGVNSPVRAFKSVGGEPFFVARADGAYLFDVDGNRYIDYVGSW 61 The following BLAST results are available for this feature:
BLAST of CX043454 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 422
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX043454 ID=CX043454; Name=CX043454; organism=Citrus sinensis; type=EST; length=378bpback to top |