CX671960
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX671960 vs. ExPASy Swiss-Prot
Match: CATA_CANBO (Peroxisomal catalase OS=Candida boidinii GN=CTA1 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.513e-11 Identity = 31/49 (63.27%), Postives = 37/49 (75.51%), Query Frame = -3 Query: 615 EQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAP 761 EQ AF P+ VPG+ SND +LQ+R+FSY DT RHRLG NY Q+PVN P Sbjct: 317 EQAAFSPSHTVPGMEPSNDPVLQSRLFSYPDTHRHRLGVNYSQIPVNCP 365
BLAST of CX671960 vs. ExPASy Swiss-Prot
Match: CAT3_NEUCR (Catalase-3 OS=Neurospora crassa GN=cat-3 PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 9.813e-11 Identity = 33/62 (53.23%), Postives = 43/62 (69.35%), Query Frame = -3 Query: 582 EQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQ--RHRLGPNYLQLPVNAPKCAQHNNHYDG 761 EQ++F P +V G+ ++ D LLQ R++SY DTQ RHR GPN+ QLP+N P HNNH DG Sbjct: 361 EQISFQPGHIVRGVDFTEDPLLQGRLYSYLDTQLNRHR-GPNFEQLPINRPVSGVHNNHRDG 421 The following BLAST results are available for this feature:
BLAST of CX671960 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 132
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX671960 ID=CX671960; Name=CX671960; organism=Citrus sinensis; type=EST; length=766bpback to top |