CV712778
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CV712778 vs. ExPASy Swiss-Prot
Match: DEF04_ARATH (Defensin-like protein 4 OS=Arabidopsis thaliana GN=PDF2.1 PE=2 SV=2) HSP 1 Score: 72.7886 bits (177), Expect = 1.255e-12 Identity = 31/52 (59.62%), Postives = 33/52 (63.46%), Query Frame = 1 Query: 118 VPAEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGVRRRCFCSKLC 273 V E R C SQS F G C S NC VC NEGF GG CRG RRRCFC++ C Sbjct: 26 VTVEARTCASQSQRFKGKCVSDTNCENVCHNEGFPGGDCRGFRRRCFCTRNC 77
BLAST of CV712778 vs. ExPASy Swiss-Prot
Match: DEF05_ARATH (Defensin-like protein 5 OS=Arabidopsis thaliana GN=PDF2.4 PE=2 SV=2) HSP 1 Score: 71.2478 bits (173), Expect = 3.652e-12 Identity = 29/53 (54.72%), Postives = 36/53 (67.92%), Query Frame = 1 Query: 115 MVPAEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGVRRRCFCSKLC 273 +V E R C++ S+ F+G C S NCA VC NEGFS G CRG RRRC C++ C Sbjct: 24 LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC 76
BLAST of CV712778 vs. ExPASy Swiss-Prot
Match: DF322_SOLTU (Defensin-like protein P322 OS=Solanum tuberosum PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 8.137e-12 Identity = 30/50 (60.00%), Postives = 32/50 (64.00%), Query Frame = 1 Query: 124 AEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGVRRRCFCSKLC 273 AE R C+S SH F G C NCA VC E FSGG C G RRRCFC+K C Sbjct: 25 AEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC 74 The following BLAST results are available for this feature:
BLAST of CV712778 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CV712778 ID=CV712778; Name=CV712778; organism=Citrus sinensis; type=EST; length=552bpback to top |