EG358253
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EG358253 vs. ExPASy Swiss-Prot
Match: DPSS_PINSY (Dihydropinosylvin synthase OS=Pinus sylvestris PE=1 SV=1) HSP 1 Score: 86.2705 bits (212), Expect = 5.432e-17 Identity = 39/57 (68.42%), Postives = 48/57 (84.21%), Query Frame = -1 Query: 8 QVPRLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYRLTKLLGLRPSVKRL 178 +VPRL KEAA KAI+EWGQ KS ITHL+FC+T+ D+PGAD+ + KLLGL PSVKR+ Sbjct: 104 EVPRLAKEAAEKAIQEWGQSKSGITHLIFCSTTTPDLPGADFEVAKLLGLHPSVKRV 160
BLAST of EG358253 vs. ExPASy Swiss-Prot
Match: TBSYN_HYPAN (Trihydroxybenzophenone synthase OS=Hypericum androsaemum PE=1 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 7.095e-17 Identity = 40/59 (67.80%), Postives = 50/59 (84.75%), Query Frame = -1 Query: 2 QVPRLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYRLTKLLGLRPSVKRLMM 178 +VP+LG+EAA KAI EWGQP SKITH+VF TTSG MPGADY +T+LLGL +V+R+M+ Sbjct: 104 EVPKLGQEAALKAIAEWGQPISKITHVVFATTSGFMMPGADYVITRLLGLNRTVRRVML 162 The following BLAST results are available for this feature:
BLAST of EG358253 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 142
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EG358253 ID=EG358253; Name=EG358253; organism=Citrus sinensis; type=EST; length=292bpback to top |