GO242092
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GO242092 vs. ExPASy Swiss-Prot
Match: RS12_PYRHO (30S ribosomal protein S12P OS=Pyrococcus horikoshii GN=rps12p PE=3 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 7.422e-11 Identity = 34/70 (48.57%), Postives = 49/70 (70.00%), Query Frame = 3 Query: 198 LINKGNKIASFKPYDGCLNYIGQNDKVLIAGFVR-KGFAVGECPGVRFKVVKVSGVSLLALFKEKKEKPR 404 LI G + +F P DG +N+I ++D+V+I G KG ++G+ PG+R+KVVKV+ VSL L K +KEKPR Sbjct: 77 LIKNGKVVTAFCPGDGAINFIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPR 146
BLAST of GO242092 vs. ExPASy Swiss-Prot
Match: RS12_METBU (30S ribosomal protein S12P OS=Methanococcoides burtonii (strain DSM 6242) GN=rps12p PE=3 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 7.832e-11 Identity = 33/77 (42.86%), Postives = 48/77 (62.34%), Query Frame = 3 Query: 177 QKMRSI*LINKGNKIASFKPYDGCLNYIGQNDKVLIAGFV-RKGFAVGECPGVRFKVVKVSGVSLLALFKEKKEKPR 404 +K I LI G + +F P DG +N+I ++D+V + R G A+G+ PGVRFKV+ V+ VSL + +KEKPR Sbjct: 65 RKCVRIQLIKNGRQATAFCPGDGAINFIDEHDEVTVERIGGRMGGAMGDIPGVRFKVIAVNNVSLREMVIGRKEKPR 141 HSP 2 Score: 25.7942 bits (55), Expect = 7.832e-11 Identity = 10/17 (58.82%), Postives = 13/17 (76.47%), Query Frame = 1 Query: 142 IGIEAY*PGSAIKKCAR 192 +G+EA P SAI+KC R Sbjct: 53 VGVEAKQPNSAIRKCVR 69 The following BLAST results are available for this feature:
BLAST of GO242092 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 52
Pagesback to topProperties
|