GO241397
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of GO241397 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 5.814e-16 Identity = 42/66 (63.64%), Postives = 49/66 (74.24%), Query Frame = 3 Query: 129 YPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFV-QAIVXGKGPLXNLADXLADPVNNN 323 YPGG+FDPLG + DP F ELKVKEIKNGRLA+ ++ GF V Q+ G GPL NLA LADP +NN Sbjct: 168 YPGGAFDPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADPWHNN 233
BLAST of GO241397 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 9.282e-14 Identity = 39/65 (60.00%), Postives = 47/65 (72.31%), Query Frame = 3 Query: 126 LYPGGSF-DPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVXGKGPLXNLADXLADPVN 317 LYPGG F DPLGLA DPE A+L++ EIK+ RLAM + GF VQA GKGPL N A L+DP++ Sbjct: 216 LYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLH 280
BLAST of GO241397 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 6.016e-13 Identity = 38/65 (58.46%), Postives = 45/65 (69.23%), Query Frame = 3 Query: 126 LYPGGSF-DPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVXGKGPLXNLADXLADPVN 317 LYPGG F DPLGLA DP A+L++ EIK+ RLAM GF VQA GKGPL N A L+DP++ Sbjct: 213 LYPGGKFFDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPLH 277 The following BLAST results are available for this feature:
BLAST of GO241397 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 73
Pagesback to topProperties
|