FC871635
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_PSEF5 (Chaperone protein htpG OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=htpG PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 6.413e-11 Identity = 29/66 (43.94%), Postives = 43/66 (65.15%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLYE 679 +N A+W R E+ +EEY +FY + DF E PL+WSH EG +E+ ++L+VP +AP DLY+ Sbjct: 233 VNRASALWTRPRTEIKDEEYQEFYKHIAHDF--ENPLSWSHNKVEGKLEYSSLLYVPARAPFDLYQ 296
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_ECOUT (Chaperone protein htpG OS=Escherichia coli (strain UTI89 / UPEC) GN=htpG PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 6.413e-11 Identity = 27/65 (41.54%), Postives = 44/65 (67.69%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N +A+W RN E+T+EEY +FY + DF++ PL WSH EG E+ ++L++P +AP D++ Sbjct: 227 INKAQALWTRNKSEITDEEYKEFYKHIAHDFNE--PLTWSHNRVEGKQEYTSLLYIPSQAPWDMW 289
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_ECOK1 (Chaperone protein htpG OS=Escherichia coli O1:K1 / APEC GN=htpG PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 6.413e-11 Identity = 27/65 (41.54%), Postives = 44/65 (67.69%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N +A+W RN E+T+EEY +FY + DF++ PL WSH EG E+ ++L++P +AP D++ Sbjct: 227 INKAQALWTRNKSEITDEEYKEFYKHIAHDFNE--PLTWSHNRVEGKQEYTSLLYIPSQAPWDMW 289
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_PSEA6 (Chaperone protein htpG OS=Pseudoalteromonas atlantica (strain T6c / BAA-1087) GN=htpG PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.376e-11 Identity = 28/65 (43.08%), Postives = 43/65 (66.15%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N A+W R+ EV++EEY +FY + DF+D PL WSH EG E+ ++L++P KAP D++ Sbjct: 239 VNKATALWTRDKSEVSDEEYKEFYKHISHDFAD--PLVWSHNKVEGKTEYNSLLYIPAKAPFDMW 301
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_HAES2 (Chaperone protein htpG OS=Haemophilus somnus (strain 2336) GN=htpG PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.376e-11 Identity = 29/65 (44.62%), Postives = 45/65 (69.23%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N +A+W R+ E+++EEY +FY L DF+D PL W+H EG+ E+ ++L+VP KAP DL+ Sbjct: 230 INKAQALWTRSKGEISDEEYKEFYKHLSHDFAD--PLLWTHNKVEGNQEYTSLLYVPSKAPWDLF 292
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_HAES1 (Chaperone protein htpG OS=Haemophilus somnus (strain 129Pt) GN=htpG PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.376e-11 Identity = 29/65 (44.62%), Postives = 45/65 (69.23%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N +A+W R+ E+++EEY +FY L DF+D PL W+H EG+ E+ ++L+VP KAP DL+ Sbjct: 230 INKAQALWTRSKGEISDEEYKEFYKHLSHDFAD--PLLWTHNKVEGNQEYTSLLYVPSKAPWDLF 292
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_BDEBA (Chaperone protein htpG OS=Bdellovibrio bacteriovorus GN=htpG PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.376e-11 Identity = 31/61 (50.82%), Postives = 43/61 (70.49%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAP 664 LN KA+WL++P EVT+EEY +FY L D+++ PL H+ AEG +EF A+L+VP K P Sbjct: 221 LNSQKALWLKSPSEVTKEEYKEFYQHLTHDWNE--PLRTVHYRAEGTMEFNALLYVPGKKP 279
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_ALCBS (Chaperone protein htpG OS=Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) GN=htpG PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.376e-11 Identity = 32/70 (45.71%), Postives = 42/70 (60.00%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLYESYYN 691 LN A+W R EVT+EEY FY + DF D L WSH EG +E+ ++L+VP +AP DLY+ N Sbjct: 226 LNSATALWQRPRSEVTDEEYQSFYKHISHDFQDA--LTWSHNKVEGKLEYTSLLYVPAQAPFDLYQREAN 293 The following BLAST results are available for this feature:
BLAST of FC871635 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 118
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC871635 ID=FC871635; Name=FC871635; organism=Citrus sinensis; type=EST; length=697bpback to top |