FC871635
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_ECOLI (Chaperone protein htpG OS=Escherichia coli (strain K12) GN=htpG PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.204e-11 Identity = 28/65 (43.08%), Postives = 44/65 (67.69%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N +A+W RN E+T+EEY +FY + DF+D PL WSH EG E+ ++L++P +AP D++ Sbjct: 227 INKAQALWTRNKSEITDEEYKEFYKHIAHDFND--PLTWSHNRVEGKQEYTSLLYIPSQAPWDMW 289
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_ECOLC (Chaperone protein htpG OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=htpG PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.204e-11 Identity = 28/65 (43.08%), Postives = 44/65 (67.69%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N +A+W RN E+T+EEY +FY + DF+D PL WSH EG E+ ++L++P +AP D++ Sbjct: 227 INKAQALWTRNKSEITDEEYKEFYKHIAHDFND--PLTWSHNRVEGKQEYTSLLYIPSQAPWDMW 289
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_ECOL6 (Chaperone protein htpG OS=Escherichia coli O6 GN=htpG PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.204e-11 Identity = 28/65 (43.08%), Postives = 44/65 (67.69%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N +A+W RN E+T+EEY +FY + DF+D PL WSH EG E+ ++L++P +AP D++ Sbjct: 227 INKAQALWTRNKSEITDEEYKEFYKHIAHDFND--PLTWSHNRVEGKQEYTSLLYIPSQAPWDMW 289
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_ECOL5 (Chaperone protein htpG OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=htpG PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.204e-11 Identity = 28/65 (43.08%), Postives = 44/65 (67.69%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N +A+W RN E+T+EEY +FY + DF+D PL WSH EG E+ ++L++P +AP D++ Sbjct: 227 INKAQALWTRNKSEITDEEYKEFYKHIAHDFND--PLTWSHNRVEGKQEYTSLLYIPSQAPWDMW 289
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_ECOHS (Chaperone protein htpG OS=Escherichia coli O9:H4 (strain HS) GN=htpG PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.204e-11 Identity = 28/65 (43.08%), Postives = 44/65 (67.69%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N +A+W RN E+T+EEY +FY + DF+D PL WSH EG E+ ++L++P +AP D++ Sbjct: 227 INKAQALWTRNKSEITDEEYKEFYKHIAHDFND--PLTWSHNRVEGKQEYTSLLYIPSQAPWDMW 289
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_ECO57 (Chaperone protein htpG OS=Escherichia coli O157:H7 GN=htpG PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.204e-11 Identity = 28/65 (43.08%), Postives = 44/65 (67.69%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N +A+W RN E+T+EEY +FY + DF+D PL WSH EG E+ ++L++P +AP D++ Sbjct: 227 INKAQALWTRNKSEITDEEYKEFYKHIAHDFND--PLTWSHNRVEGKQEYTSLLYIPSQAPWDMW 289
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_ECO24 (Chaperone protein htpG OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=htpG PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.204e-11 Identity = 28/65 (43.08%), Postives = 44/65 (67.69%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N +A+W RN E+T+EEY +FY + DF+D PL WSH EG E+ ++L++P +AP D++ Sbjct: 227 INKAQALWTRNKSEITDEEYKEFYKHIAHDFND--PLTWSHNRVEGKQEYTSLLYIPSQAPWDMW 289
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_SHELP (Chaperone protein htpG OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=htpG PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.879e-11 Identity = 30/65 (46.15%), Postives = 43/65 (66.15%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLY 676 +N A+W RN +VT+EEY +FY + DF+D PL WSH EG E+ ++L++P KAP DL+ Sbjct: 238 MNKATALWTRNKSDVTDEEYQEFYKHISHDFAD--PLLWSHNRVEGKQEYTSLLYIPSKAPWDLW 300
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_PHOPR (Chaperone protein htpG OS=Photobacterium profundum GN=htpG PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.760e-11 Identity = 29/64 (45.31%), Postives = 44/64 (68.75%), Query Frame = 2 Query: 482 LNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDL 673 +N +A+W RN E+TEEEY +FY+ + DF++ PL WSH EG ++ ++L+VP KAP D+ Sbjct: 235 INKAQALWTRNKSEITEEEYKEFYNHVSHDFAE--PLTWSHNRVEGTQDYTSLLYVPSKAPWDM 296
BLAST of FC871635 vs. ExPASy Swiss-Prot
Match: HTPG_MYXXD (Chaperone protein htpG OS=Myxococcus xanthus (strain DK 1622) GN=htpG PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.760e-11 Identity = 29/65 (44.62%), Postives = 44/65 (67.69%), Query Frame = 2 Query: 479 LLNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDL 673 ++N A+W R+ E+T+E+Y +FY L D+ E PLAW+HF A+G+ +F +LFVP + P DL Sbjct: 235 VVNKASALWQRSKSEITDEQYQEFYKHLTHDW--EAPLAWTHFKADGNTQFTGLLFVPKQPPFDL 297 The following BLAST results are available for this feature:
BLAST of FC871635 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 118
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC871635 ID=FC871635; Name=FC871635; organism=Citrus sinensis; type=EST; length=697bpback to top |