DY257095
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DY257095 vs. ExPASy Swiss-Prot
Match: ENY2_DROME (Enhancer of yellow 2 transcription factor OS=Drosophila melanogaster GN=e(y)2 PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 3.670e-11 Identity = 29/58 (50.00%), Postives = 43/58 (74.14%), Query Frame = 1 Query: 226 ECGWKDEMKALCRAYIKKKGTNN-VTVDDLVHVITPKGRASIPDSIKTELLLRIRAFL 396 ECGW+DE++ +CR + +KGTNN TV+ L+ +TPK R +PD++K ELL++IR L Sbjct: 30 ECGWRDEVRLMCRNILMEKGTNNSFTVEQLIAEVTPKARTLVPDAVKKELLMKIRTIL 87
BLAST of DY257095 vs. ExPASy Swiss-Prot
Match: ENY2_DROER (Enhancer of yellow 2 transcription factor OS=Drosophila erecta GN=e(y)2 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 3.670e-11 Identity = 30/58 (51.72%), Postives = 43/58 (74.14%), Query Frame = 1 Query: 226 ECGWKDEMKALCRAYIKKKGTNN-VTVDDLVHVITPKGRASIPDSIKTELLLRIRAFL 396 ECGW+DE++ +CR + +KGTNN TV+ L+ +TPK R +PD+IK ELL++IR L Sbjct: 30 ECGWRDEVRLMCRNILLEKGTNNSFTVEQLITEVTPKARTLVPDAIKKELLMKIRTIL 87
BLAST of DY257095 vs. ExPASy Swiss-Prot
Match: ENY2_DICDI (Enhancer of yellow 2 transcription factor homolog OS=Dictyostelium discoideum GN=eny2 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 3.670e-11 Identity = 33/84 (39.29%), Postives = 47/84 (55.95%), Query Frame = 1 Query: 145 LQEIINIKMIESGXXXXXXXXXXXXXVECGWKDEMKALCRAYIKKKGTNNVTVDDLVHVITPKGRASIPDSIKTELLLRIRAFL 396 L+ I+ K+IESG VE GW+DE+K CR YIK N ++DL+ +ITP + +P +K +L+ RIR FL Sbjct: 16 LRSTIHQKLIESGEKERLKVLLKSKLVEGGWRDEVKIACREYIKNNQNENFKIEDLIALITPIAKKKVPPQVKADLIKRIRKFL 99
BLAST of DY257095 vs. ExPASy Swiss-Prot
Match: ENY2_DROYA (Enhancer of yellow 2 transcription factor OS=Drosophila yakuba GN=e(y)2 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 4.794e-11 Identity = 29/58 (50.00%), Postives = 43/58 (74.14%), Query Frame = 1 Query: 226 ECGWKDEMKALCRAYIKKKGTNN-VTVDDLVHVITPKGRASIPDSIKTELLLRIRAFL 396 ECGW+DE++ +CR + +KGTNN TV+ L+ +TPK R +PD++K ELL++IR L Sbjct: 30 ECGWRDEVRLMCRNILLEKGTNNSFTVEQLITEVTPKARTLVPDAVKKELLMKIRTIL 87
BLAST of DY257095 vs. ExPASy Swiss-Prot
Match: ENY2_DROSI (Enhancer of yellow 2 transcription factor OS=Drosophila simulans GN=e(y)2 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 4.794e-11 Identity = 29/58 (50.00%), Postives = 43/58 (74.14%), Query Frame = 1 Query: 226 ECGWKDEMKALCRAYIKKKGTNN-VTVDDLVHVITPKGRASIPDSIKTELLLRIRAFL 396 ECGW+DE++ +CR + +KGTNN TV+ L+ +TPK R +PD++K ELL++IR L Sbjct: 30 ECGWRDEVRLMCRNILNEKGTNNSFTVEQLIAEVTPKARTLVPDAVKKELLMKIRNIL 87
BLAST of DY257095 vs. ExPASy Swiss-Prot
Match: ENY2_DROMO (Enhancer of yellow 2 transcription factor OS=Drosophila mojavensis GN=e(y)2 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 4.794e-11 Identity = 32/87 (36.78%), Postives = 51/87 (58.62%), Query Frame = 1 Query: 142 TLQEIINIKMIESGXXXXXXXXXXXXXVECGWKDEMKALCR-AYIKKKGTNNVTVDDLVHVITPKGRASIPDSIKTELLLRIRAFLA 399 T+ ++ I SG ECGW+DE++ LCR ++K G N+++V+ L+ +TPK R +PD++K ELL++IR LA Sbjct: 2 TVSNTVDQYTIMSGDRSKIKDLLCNRLTECGWRDEVRLLCRNILVEKNGNNSLSVEQLIAEVTPKARTLVPDAVKKELLMKIRTILA 88
BLAST of DY257095 vs. ExPASy Swiss-Prot
Match: ENY2_DROSE (Enhancer of yellow 2 transcription factor OS=Drosophila sechellia GN=e(y)2 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 6.261e-11 Identity = 29/58 (50.00%), Postives = 43/58 (74.14%), Query Frame = 1 Query: 226 ECGWKDEMKALCRAYIKKKGTNN-VTVDDLVHVITPKGRASIPDSIKTELLLRIRAFL 396 ECGW+DE++ +CR + +KGTNN TV+ L+ +TPK R +PD++K ELL++IR L Sbjct: 30 ECGWRDEVRLMCRNILIEKGTNNSFTVEQLIAEVTPKARTLVPDAVKKELLMKIRTIL 87
BLAST of DY257095 vs. ExPASy Swiss-Prot
Match: ENY2_DROAN (Enhancer of yellow 2 transcription factor OS=Drosophila ananassae GN=e(y)2 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 6.261e-11 Identity = 29/58 (50.00%), Postives = 43/58 (74.14%), Query Frame = 1 Query: 226 ECGWKDEMKALCRAYIKKKGT-NNVTVDDLVHVITPKGRASIPDSIKTELLLRIRAFL 396 ECGW+DE++ LCR + +KGT N+ TV+ L+ +TPK R +PD++K ELL++IR L Sbjct: 30 ECGWRDEVRLLCRTILLEKGTGNSFTVEQLITEVTPKARTLVPDAVKKELLMKIRTIL 87
BLAST of DY257095 vs. ExPASy Swiss-Prot
Match: ENY2_DROGR (Enhancer of yellow 2 transcription factor OS=Drosophila grimshawi GN=e(y)2 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 8.177e-11 Identity = 33/87 (37.93%), Postives = 51/87 (58.62%), Query Frame = 1 Query: 142 TLQEIINIKMIESGXXXXXXXXXXXXXVECGWKDEMKALCRAYIKKKGTNN-VTVDDLVHVITPKGRASIPDSIKTELLLRIRAFLA 399 T+ + ++ I SG ECGW++E++ LCR + +K NN V+VD L+ +TPK R +PD++K ELL++IR LA Sbjct: 2 TICDTVDQYTIMSGDRLKIKDLLCNRLTECGWRNEVRLLCRNILLEKSANNSVSVDQLISEVTPKARTLVPDAVKKELLMKIRTILA 88 The following BLAST results are available for this feature:
BLAST of DY257095 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 19
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DY257095 ID=DY257095; Name=DY257095; organism=Citrus sinensis; type=EST; length=806bpback to top |