DT214565

Overview
NameDT214565
Unique NameDT214565
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214565_ssr591 microsatellite DT214565_ssr591:591..614. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7552 contig Csv1_Contig7552:60..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_ACECL (Ribulose bisphosphate carboxylase small chain 1 (Fragment) OS=Acetabularia cliftonii GN=RBCS-1 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.418e-15
Identity = 33/61 (54.10%), Postives = 43/61 (70.49%), Query Frame = -3
Query:  133 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 315
            Y D RYWTMWKLPM+GCTD +QVL E+    K +P +++R++ FD  RQVQ   FL  +PP
Sbjct:   53 YQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPP 113          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_ACEAT (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Acetabularia acetabulum GN=RBCS-1 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.418e-15
Identity = 33/61 (54.10%), Postives = 43/61 (70.49%), Query Frame = -3
Query:  133 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 315
            Y D RYWTMWKLPM+GCTD +QVL E+    K +P +++R++ FD  RQVQ   FL  +PP
Sbjct:  109 YQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPP 169          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS6_ACECL (Ribulose bisphosphate carboxylase small chain 6, chloroplastic OS=Acetabularia cliftonii GN=RBCS-6 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.769e-15
Identity = 33/61 (54.10%), Postives = 43/61 (70.49%), Query Frame = -3
Query:  133 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 315
            Y D RYWTMWKLPM+GCTD +QVL E+    K +P +++R++ FD  RQVQ   FL  +PP
Sbjct:  109 YQDNRYWTMWKLPMFGCTDGSQVLTEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPP 169          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS7_ACECL (Ribulose bisphosphate carboxylase small chain 7, chloroplastic OS=Acetabularia cliftonii GN=RBCS-7 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.285e-14
Identity = 32/61 (52.46%), Postives = 43/61 (70.49%), Query Frame = -3
Query:  133 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 315
            Y D RYWTMWKLPM+GCTD +QVL ++    K +P +++R++ FD  RQVQ   FL  +PP
Sbjct:  110 YQDNRYWTMWKLPMFGCTDGSQVLSDMQACTKAFPDAYIRLVCFDANRQVQICGFLVHRPP 170          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS5_ACEAT (Ribulose bisphosphate carboxylase small chain 5, chloroplastic OS=Acetabularia acetabulum GN=RBCS-5 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.679e-14
Identity = 32/61 (52.46%), Postives = 42/61 (68.85%), Query Frame = -3
Query:  133 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 315
            Y D RYWTMWKLPM+GCTD +QVL E+      +P +++R++ FD  RQVQ   FL  +PP
Sbjct:  110 YQDNRYWTMWKLPMFGCTDGSQVLSEIQACTNAFPDAYIRLVCFDANRQVQISGFLVHRPP 170          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS4_ACEAT (Ribulose bisphosphate carboxylase small chain 4, chloroplastic OS=Acetabularia acetabulum GN=RBCS-4 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.679e-14
Identity = 32/61 (52.46%), Postives = 42/61 (68.85%), Query Frame = -3
Query:  133 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 315
            Y D RYWTMWKLPM+GCTD +QVL E+      +P +++R++ FD  RQVQ   FL  +PP
Sbjct:  109 YQDNRYWTMWKLPMFGCTDGSQVLSEIQACTNAFPDAYIRLVCFDANRQVQISGFLVHRPP 169          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_BATOE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Batophora oerstedii GN=RBCS PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 1.088e-13
Identity = 31/60 (51.67%), Postives = 41/60 (68.33%), Query Frame = -3
Query:  136 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 315
            Y D RYWTMWKLPM+GC D +QVL E+    K +P +++R++ FD  RQVQ   FL  +P
Sbjct:  102 YQDNRYWTMWKLPMFGCIDGSQVLTEISACTKAFPDAYIRLVCFDANRQVQISGFLVHRP 161          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_PROHO (Ribulose bisphosphate carboxylase small chain OS=Prochlorothrix hollandica GN=cbbS PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.970e-12
Identity = 28/55 (50.91%), Postives = 40/55 (72.73%), Query Frame = -3
Query:  136 YWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 300
            YWTMWKLP++  T   +VL EV E + EYP+ ++R++GFDN +Q Q +SF+  KP
Sbjct:   52 YWTMWKLPLFHATSTQEVLGEVRECRTEYPNCYIRVVGFDNIKQCQSVSFIVHKP 106          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_THIFE (Ribulose bisphosphate carboxylase small chain 2 OS=Thiobacillus ferrooxidans GN=cbbS2 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.018e-11
Identity = 32/71 (45.07%), Postives = 41/71 (57.75%), Query Frame = -3
Query:  148 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFL 360
            + KGW     H+ P    G YW MWKLPM+G TD   +LKE     K  PH+ VRI+G+DN +Q Q  S +
Sbjct:   41 VSKGWNPAVEHTEPENAFGNYWYMWKLPMFGETDVDTILKEAERCHKRNPHNHVRIVGYDNFKQSQGTSLV 111          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_SYNP6 (Ribulose bisphosphate carboxylase small chain OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cbbS PE=1 SV=3)

HSP 1 Score: 69.3218 bits (168), Expect = 2.269e-11
Identity = 30/65 (46.15%), Postives = 42/65 (64.62%), Query Frame = -3
Query:  136 HSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 330
            HS+P  +   YWTMWKLP++ C    QVL EV E + EY   ++R+ GFDN +Q Q +SF+  +P
Sbjct:   47 HSNPEEF---YWTMWKLPLFDCKSPQQVLDEVRECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRP 108          
The following BLAST results are available for this feature:
BLAST of DT214565 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
RBS1_ACECL4.418e-1554.10Ribulose bisphosphate carboxylase small chain 1 (F... [more]
RBS1_ACEAT4.418e-1554.10Ribulose bisphosphate carboxylase small chain 1, c... [more]
RBS6_ACECL5.769e-1554.10Ribulose bisphosphate carboxylase small chain 6, c... [more]
RBS7_ACECL1.285e-1452.46Ribulose bisphosphate carboxylase small chain 7, c... [more]
RBS5_ACEAT1.679e-1452.46Ribulose bisphosphate carboxylase small chain 5, c... [more]
RBS4_ACEAT1.679e-1452.46Ribulose bisphosphate carboxylase small chain 4, c... [more]
RBS_BATOE1.088e-1351.67Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_PROHO5.970e-1250.91Ribulose bisphosphate carboxylase small chain OS=P... [more]
RBS2_THIFE1.018e-1145.07Ribulose bisphosphate carboxylase small chain 2 OS... [more]
RBS_SYNP62.269e-1146.15Ribulose bisphosphate carboxylase small chain OS=S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_22B11_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-22B11-C22-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214565 ID=DT214565|Name=DT214565|organism=Citrus sinensis|type=EST|length=713bp
ACAGCAGCCTAAGTAAAATTAAACGCAAACCGAACCCCCATTGATCGAAT
GATCATTATGGGGGTTACACATAATAATAATCAACAATATTGCATGGGTG
GTTACACAAATTTAATTGGGAACCTAGACGCCTGGTGGCTTGGCAGCAAG
GAAACTGATGCACTGCACTTGACGCTTGTTGTCAAATCCGATAATTCGGA
CGAATGAATGTGGGTATTCCTTCTGGACCTCCCCAACCTCCTTCAAAACC
TGGGTTGCATCTGTGCACCCATACATGGGCAGCTTCCACATTGTCCAGTA
GCGTCCATCGTAGTATCCTGGTGAGCTGTGGTGCTCACGGTACACCCATC
CTTTCTGCAGTCACGCCACCCAAAAGAAAAAACAAAAAAAAAAAAAAATC
AAATATCACCACCCATTTGCCTGATAAAATCCGCTTAACCCAAAAGCTTA
AATTTTAAGTAAGCAATTGTTAATGCAGGTTTTGATATTGAATGGATATC
TCTGACCAATAAATTCATGACATGTGTAATTTTTCTCCTAAAGCACATAA
ATAAGGTTCCGTCAAAATAATAGTATATATTAAGAGAGACAGAGAGAGAG
AGAGAGAGAGAGAGAAATGACCTCCAACTCAAATTCCAAGCAGGAAATCC
AGCCGGAGCGGAGAAGGTAACTGATTTCCTTGAGCAAAGCTTCATCGGAC
AGTGGCGGGAGGT
back to top