DT214565

Overview
NameDT214565
Unique NameDT214565
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214565_ssr591 microsatellite DT214565_ssr591:591..614. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7552 contig Csv1_Contig7552:60..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_ORYSJ (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Oryza sativa subsp. japonica GN=RBCS PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.279e-30
Identity = 59/74 (79.73%), Postives = 66/74 (89.19%), Query Frame = -3
Query:  130 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 351
            G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVLKE+ E +K YP +FVRIIGFDN RQVQ ISF+A KPPG
Sbjct:   95 GFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPG 168          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_ORYSI (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Oryza sativa subsp. indica GN=RBCS PE=2 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 1.279e-30
Identity = 59/74 (79.73%), Postives = 66/74 (89.19%), Query Frame = -3
Query:  130 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 351
            G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVLKE+ E +K YP +FVRIIGFDN RQVQ ISF+A KPPG
Sbjct:   95 GFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPG 168          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_CAPAN (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Capsicum annuum GN=RBCS PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.182e-30
Identity = 57/74 (77.03%), Postives = 65/74 (87.84%), Query Frame = -3
Query:  136 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 357
            + G+VYREHH SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF+A KP
Sbjct:  104 EHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_SPIOL (Ribulose bisphosphate carboxylase small chain 2, chloroplastic OS=Spinacia oleracea GN=RBCS2 PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.182e-30
Identity = 55/74 (74.32%), Postives = 66/74 (89.19%), Query Frame = -3
Query:  130 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 351
            G+VYREHH+SPGYYDGRYWTMWKLPM+GCTD  QVL E+ E +KEYP++F+RIIGFD+ RQVQC+SF+A KP G
Sbjct:  106 GFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKPAG 179          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_SOYBN (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Glycine max GN=RBCS-1 PE=3 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.182e-30
Identity = 57/77 (74.03%), Postives = 67/77 (87.01%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G+VYREH+ SP YYDGRYWTMWKLPM+GCTDA+QVLKE+ E +  YP+ F+RIIGFDN RQVQCISF+A KPPG
Sbjct:  101 LEHGFVYREHNRSPXYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPPG 177          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS6_LEMGI (Ribulose bisphosphate carboxylase small chain SSU5B, chloroplastic OS=Lemna gibba GN=SSU5B PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.850e-30
Identity = 57/74 (77.03%), Postives = 67/74 (90.54%), Query Frame = -3
Query:  136 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 357
            ++G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTDA+QV+ EV E +K YP  FVRIIGFDNKRQVQCISF+A KP
Sbjct:  103 KEGFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS5_LEMGI (Ribulose bisphosphate carboxylase small chain SSU5A, chloroplastic OS=Lemna gibba GN=SSU5A PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.850e-30
Identity = 57/74 (77.03%), Postives = 67/74 (90.54%), Query Frame = -3
Query:  136 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 357
            ++G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTDA+QV+ EV E +K YP  FVRIIGFDNKRQVQCISF+A KP
Sbjct:  103 KEGFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS4_LEMGI (Ribulose bisphosphate carboxylase small chain SSU40B, chloroplastic OS=Lemna gibba GN=SSU40B PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.850e-30
Identity = 57/74 (77.03%), Postives = 67/74 (90.54%), Query Frame = -3
Query:  136 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 357
            ++G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTDA+QV+ EV E +K YP  FVRIIGFDNKRQVQCISF+A KP
Sbjct:  103 KEGFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3_LEMGI (Ribulose bisphosphate carboxylase small chain SSU40A, chloroplastic OS=Lemna gibba GN=SSU40A PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.850e-30
Identity = 57/74 (77.03%), Postives = 67/74 (90.54%), Query Frame = -3
Query:  136 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 357
            ++G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTDA+QV+ EV E +K YP  FVRIIGFDNKRQVQCISF+A KP
Sbjct:  103 KEGFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3B_SOLLC (Ribulose bisphosphate carboxylase small chain 3B, chloroplastic OS=Solanum lycopersicum GN=RBCS-3B PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.850e-30
Identity = 58/76 (76.32%), Postives = 66/76 (86.84%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP ++VRIIGFDN RQVQCISF+A KP G
Sbjct:  104 EHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179          
The following BLAST results are available for this feature:
BLAST of DT214565 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
RBS1_ORYSJ1.279e-3079.73Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS1_ORYSI1.279e-3079.73Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_CAPAN2.182e-3077.03Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS2_SPIOL2.182e-3074.32Ribulose bisphosphate carboxylase small chain 2, c... [more]
RBS1_SOYBN2.182e-3074.03Ribulose bisphosphate carboxylase small chain 1, c... [more]
RBS6_LEMGI2.850e-3077.03Ribulose bisphosphate carboxylase small chain SSU5... [more]
RBS5_LEMGI2.850e-3077.03Ribulose bisphosphate carboxylase small chain SSU5... [more]
RBS4_LEMGI2.850e-3077.03Ribulose bisphosphate carboxylase small chain SSU4... [more]
RBS3_LEMGI2.850e-3077.03Ribulose bisphosphate carboxylase small chain SSU4... [more]
RBS3B_SOLLC2.850e-3076.32Ribulose bisphosphate carboxylase small chain 3B, ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_22B11_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-22B11-C22-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214565 ID=DT214565|Name=DT214565|organism=Citrus sinensis|type=EST|length=713bp
ACAGCAGCCTAAGTAAAATTAAACGCAAACCGAACCCCCATTGATCGAAT
GATCATTATGGGGGTTACACATAATAATAATCAACAATATTGCATGGGTG
GTTACACAAATTTAATTGGGAACCTAGACGCCTGGTGGCTTGGCAGCAAG
GAAACTGATGCACTGCACTTGACGCTTGTTGTCAAATCCGATAATTCGGA
CGAATGAATGTGGGTATTCCTTCTGGACCTCCCCAACCTCCTTCAAAACC
TGGGTTGCATCTGTGCACCCATACATGGGCAGCTTCCACATTGTCCAGTA
GCGTCCATCGTAGTATCCTGGTGAGCTGTGGTGCTCACGGTACACCCATC
CTTTCTGCAGTCACGCCACCCAAAAGAAAAAACAAAAAAAAAAAAAAATC
AAATATCACCACCCATTTGCCTGATAAAATCCGCTTAACCCAAAAGCTTA
AATTTTAAGTAAGCAATTGTTAATGCAGGTTTTGATATTGAATGGATATC
TCTGACCAATAAATTCATGACATGTGTAATTTTTCTCCTAAAGCACATAA
ATAAGGTTCCGTCAAAATAATAGTATATATTAAGAGAGACAGAGAGAGAG
AGAGAGAGAGAGAGAAATGACCTCCAACTCAAATTCCAAGCAGGAAATCC
AGCCGGAGCGGAGAAGGTAACTGATTTCCTTGAGCAAAGCTTCATCGGAC
AGTGGCGGGAGGT
back to top