EY756669
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY756669 vs. ExPASy Swiss-Prot
Match: CALM_COLTR (Calmodulin OS=Colletotrichum trifolii PE=3 SV=2) HSP 1 Score: 68.5514 bits (166), Expect = 4.700e-11 Identity = 31/41 (75.61%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 23 ISSPELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYED 145 IS+ ELRHVMT++GEKLTD+EVDEMIREAD DGDG+I+Y + Sbjct: 101 ISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNE 141
BLAST of EY756669 vs. ExPASy Swiss-Prot
Match: CALM_COLGL (Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2) HSP 1 Score: 68.5514 bits (166), Expect = 4.700e-11 Identity = 31/41 (75.61%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 23 ISSPELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYED 145 IS+ ELRHVMT++GEKLTD+EVDEMIREAD DGDG+I+Y + Sbjct: 101 ISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNE 141
BLAST of EY756669 vs. ExPASy Swiss-Prot
Match: CALM_ASPOR (Calmodulin OS=Aspergillus oryzae GN=cmdA PE=3 SV=2) HSP 1 Score: 68.5514 bits (166), Expect = 4.700e-11 Identity = 31/41 (75.61%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 23 ISSPELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYED 145 IS+ ELRHVMT++GEKLTD+EVDEMIREAD DGDG+I+Y + Sbjct: 101 ISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNE 141
BLAST of EY756669 vs. ExPASy Swiss-Prot
Match: CALM_AJECG (Calmodulin OS=Ajellomyces capsulata (strain ATCC 26029 / G186AR / H82 / RMSCC 2432) GN=CAM1 PE=2 SV=2) HSP 1 Score: 68.5514 bits (166), Expect = 4.700e-11 Identity = 31/41 (75.61%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 23 ISSPELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYED 145 IS+ ELRHVMT++GEKLTD+EVDEMIREAD DGDG+I+Y + Sbjct: 101 ISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNE 141
BLAST of EY756669 vs. ExPASy Swiss-Prot
Match: CALL_DROME (Calmodulin-related protein 97A OS=Drosophila melanogaster GN=And PE=1 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 6.138e-11 Identity = 32/41 (78.05%), Postives = 35/41 (85.37%), Query Frame = 2 Query: 23 ISSPELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYED 145 IS ELR VM NLGEK+TDEE+DEMIREAD DGDG INYE+ Sbjct: 100 ISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEE 140 The following BLAST results are available for this feature:
BLAST of EY756669 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 125
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY756669 ID=EY756669; Name=EY756669; organism=Citrus sinensis; type=EST; length=797bpback to top |