CX287284
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX287284 vs. ExPASy Swiss-Prot
Match: PYR1_YEAST (Protein URA1 OS=Saccharomyces cerevisiae GN=URA2 PE=1 SV=4) HSP 1 Score: 51.9878 bits (123), Expect = 6.552e-11 Identity = 35/98 (35.71%), Postives = 51/98 (52.04%), Query Frame = 2 Query: 5 LNVCGLMNCQYAITTSGDAYLLEANPRASRTVPFVSKAIGHPLAKYAALVMSGKSLNDLGFTKEVIP-KHVSVKEAVLPFEKFQGWDVLLGPEMISTG 295 L + G N Q+ I + ++E N RASR+ PF+SK +G L + A + G L + E +P +V+VK F + G D +LG EM STG Sbjct: 1240 LKITGPYNIQF-IAKDNEIKVIECNVRASRSFPFISKVVGVNLIELATKAIMGLPLTP--YPVEKLPDDYVAVKVPQFSFPRLAGADPVLGVEMASTG 1334 HSP 2 Score: 35.4242 bits (80), Expect = 6.552e-11 Identity = 20/63 (31.75%), Postives = 33/63 (52.38%), Query Frame = 1 Query: 328 AFAKAQIAAGQKLPLSGTVFLSLNDLTKPHLERIAEAFLDIGFTIVSTSGTAHFVELKGIAVE 516 A+ K+ +A G KLP + + K L + ++G+ + +TSGTA F+ GIAV+ Sbjct: 1346 AYLKSLLATGFKLPKKNILLSIGSYKEKQELLSSVQKLYNMGYKLFATSGTADFLSEHGIAVQ 1408 The following BLAST results are available for this feature:
BLAST of CX287284 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 231
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287284 ID=CX287284; Name=CX287284; organism=Citrus clementina; type=EST; length=533bpback to top |