CX289417
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX289417 vs. ExPASy Swiss-Prot
Match: YPT7_YEAST (GTP-binding protein YPT7 OS=Saccharomyces cerevisiae GN=YPT7 PE=1 SV=1) HSP 1 Score: 46.2098 bits (108), Expect = 7.359e-12 Identity = 21/28 (75.00%), Postives = 26/28 (92.86%), Query Frame = 3 Query: 90 MPSRRRTLLKVIILGDSGVGKTSLMNQY 173 M SR++ +LKVIILGDSGVGKTSLM++Y Sbjct: 1 MSSRKKNILKVIILGDSGVGKTSLMHRY 28 HSP 2 Score: 43.1282 bits (100), Expect = 7.359e-12 Identity = 19/23 (82.61%), Postives = 21/23 (91.30%), Query Frame = 2 Query: 284 RYVNKKFSNQFKATIGADFLTKE 352 RYVN K+S Q+KATIGADFLTKE Sbjct: 27 RYVNDKYSQQYKATIGADFLTKE 49
BLAST of CX289417 vs. ExPASy Swiss-Prot
Match: YPT71_SCHPO (GTP-binding protein ypt71 OS=Schizosaccharomyces pombe GN=ypt71 PE=2 SV=1) HSP 1 Score: 43.8986 bits (102), Expect = 2.716e-11 Identity = 18/30 (60.00%), Postives = 26/30 (86.67%), Query Frame = 2 Query: 284 RYVNKKFSNQFKATIGADFLTKEAQFEDRL 373 ++VN+KFS ++KATIGADFLTK+ +D+L Sbjct: 27 QFVNQKFSREYKATIGADFLTKDVVVDDKL 56 HSP 2 Score: 43.5134 bits (101), Expect = 2.716e-11 Identity = 19/28 (67.86%), Postives = 24/28 (85.71%), Query Frame = 3 Query: 90 MPSRRRTLLKVIILGDSGVGKTSLMNQY 173 M +++R LKV+ILGDSGVGKT LMNQ+ Sbjct: 1 MSAQKRVFLKVVILGDSGVGKTCLMNQF 28 The following BLAST results are available for this feature:
BLAST of CX289417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 22
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX289417 ID=CX289417; Name=CX289417; organism=Citrus clementina; type=EST; length=378bpback to top |