CX291632
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX291632 vs. ExPASy Swiss-Prot
Match: PERP7_BRARA (Peroxidase P7 OS=Brassica rapa PE=1 SV=3) HSP 1 Score: 66.6254 bits (161), Expect = 6.374e-11 Identity = 32/72 (44.44%), Postives = 47/72 (65.28%), Query Frame = 2 Query: 2 YFSNLRGRKGLLQSDQELFSTPGADTAAIVEDFGRNQNAFFKNFVTSMIRMGNLKPLTGNQGEIRLNCRRVN 217 YF NL ++GLL SDQ LF+ G T +IV + + ++F +F +MI+MG++ PLTG+ GEIR C + N Sbjct: 227 YFKNLMAQRGLLHSDQVLFN--GGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN 296
BLAST of CX291632 vs. ExPASy Swiss-Prot
Match: PERN_ARMRU (Peroxidase N OS=Armoracia rusticana GN=HRPN PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 6.374e-11 Identity = 38/74 (51.35%), Postives = 48/74 (64.86%), Query Frame = 2 Query: 2 YFSNLRGRKGLLQSDQELFSTPGA--DTAAIVEDFGRNQNAFFKNFVTSMIRMGNLKPLTGNQGEIRLNCRRVN 217 YF NL KGLL SDQ LFS+ A T +VE + R+Q FF++F SMIRMG+L + G GE+R NCR +N Sbjct: 256 YFKNLLEGKGLLSSDQILFSSDLAVNTTKRLVEAYSRSQYLFFRDFTCSMIRMGSL--VNGASGEVRTNCRVIN 327 The following BLAST results are available for this feature:
BLAST of CX291632 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 42
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX291632 ID=CX291632; Name=CX291632; organism=Citrus clementina; type=EST; length=483bpback to top |