CX292228
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX292228 vs. ExPASy Swiss-Prot
Match: RL28_NITEU (50S ribosomal protein L28 OS=Nitrosomonas europaea GN=rpmB PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 5.928e-11 Identity = 30/70 (42.86%), Postives = 47/70 (67.14%), Query Frame = 3 Query: 252 RVCPFTGKKSNKANKVSFSNHKTTKRQFVNLQYKKVWWEAGKRYVKLRLSTKALKTIEKNGLDAVAKKAR 461 RVC TGK+ + VS +N+KT +R NLQ ++ W E+ R+++LRL+ AL+T++KNG+D+V R Sbjct: 3 RVCQVTGKRPMSGHNVSHANNKTKRRFLPNLQSRRFWLESENRWIRLRLTNAALRTVDKNGIDSVVADMR 72
BLAST of CX292228 vs. ExPASy Swiss-Prot
Match: RL28_BURXL (50S ribosomal protein L28 OS=Burkholderia xenovorans (strain LB400) GN=rpmB PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.743e-11 Identity = 32/70 (45.71%), Postives = 45/70 (64.29%), Query Frame = 3 Query: 252 RVCPFTGKKSNKANKVSFSNHKTTKRQFVNLQYKKVWWEAGKRYVKLRLSTKALKTIEKNGLDAVAKKAR 461 RVC TGK N VS +N+KT +R NLQ +++W E+ R+V+LR+S L+ I+KNG+DAV R Sbjct: 3 RVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRIWVESENRWVRLRVSNAGLRLIDKNGIDAVLADLR 72 The following BLAST results are available for this feature:
BLAST of CX292228 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 72
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX292228 ID=CX292228; Name=CX292228; organism=Citrus clementina; type=EST; length=673bpback to top |