CX293840
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX293840 vs. ExPASy Swiss-Prot
Match: TT16_ARATH (Protein TRANSPARENT TESTA 16 OS=Arabidopsis thaliana GN=TT16 PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 6.864e-11 Identity = 34/59 (57.63%), Postives = 42/59 (71.19%), Query Frame = 1 Query: 244 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN--NSVRATIDRY 414 N T RQVTF KRR GL+KK ELS+LCDA + LIVFS+ G+L E+ + N + IDRY Sbjct: 13 NQTARQVTFSKRRTGLIKKTRELSILCDAHIGLIVFSATGKLSEFCSEQNRMPQLIDRY 71
BLAST of CX293840 vs. ExPASy Swiss-Prot
Match: MADS4_ORYSJ (MADS-box transcription factor 4 OS=Oryza sativa subsp. japonica GN=MADS4 PE=1 SV=3) HSP 1 Score: 66.6254 bits (161), Expect = 6.864e-11 Identity = 30/45 (66.67%), Postives = 38/45 (84.44%), Query Frame = 1 Query: 244 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY 378 N+TNRQVTF KRR G+LKKA E+ VLCDAEV +++FSS G+L +Y Sbjct: 13 NSTNRQVTFSKRRAGILKKAREIGVLCDAEVGVVIFSSAGKLSDY 57
BLAST of CX293840 vs. ExPASy Swiss-Prot
Match: MAD20_ORYSJ (MADS-box transcription factor 20 OS=Oryza sativa subsp. japonica GN=MADS20 PE=2 SV=2) HSP 1 Score: 66.6254 bits (161), Expect = 6.864e-11 Identity = 31/61 (50.82%), Postives = 47/61 (77.05%), Query Frame = 1 Query: 244 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANN--SVRATIDRYKK 420 N +RQVTF KRR GLLKKA+E++VLCD +VA IVFS++G L+ YA++ ++ +++Y + Sbjct: 13 NEVSRQVTFSKRRPGLLKKAHEIAVLCDVDVAAIVFSAKGNLFHYASSHTTMERILEKYDR 73 The following BLAST results are available for this feature:
BLAST of CX293840 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 113
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX293840 ID=CX293840; Name=CX293840; organism=Citrus clementina; type=EST; length=494bpback to top |