CX294355
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX294355 vs. ExPASy Swiss-Prot
Match: HFC1A_ORYSJ (Heat stress transcription factor C-1a OS=Oryza sativa subsp. japonica GN=HSFC1A PE=2 SV=2) HSP 1 Score: 70.0922 bits (170), Expect = 7.807e-12 Identity = 31/41 (75.61%), Postives = 35/41 (85.37%), Query Frame = 2 Query: 11 SFVRQLNTYGFRKIDPDQWEFANEEFIRGQRHLLKNIHRRK 133 SFVRQLNTYGFRK+ PD+WEFA+E F+RGQ HLL I RRK Sbjct: 77 SFVRQLNTYGFRKVHPDRWEFAHESFLRGQTHLLPRIVRRK 117
BLAST of CX294355 vs. ExPASy Swiss-Prot
Match: HFB4B_ORYSJ (Heat stress transcription factor B-4b OS=Oryza sativa subsp. japonica GN=HSFB4B PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.020e-11 Identity = 35/53 (66.04%), Postives = 39/53 (73.58%), Query Frame = 2 Query: 11 SFVRQLNTYGFRKIDPDQWEFANEEFIRGQRHLLKNIHRRKPVHSHSTQSPTP 169 SFVRQLNTYGFRKI D+WEFANE F +G +HLL IHRRK S+Q P P Sbjct: 85 SFVRQLNTYGFRKIVADRWEFANEFFRKGAKHLLAEIHRRK-----SSQPPPP 132
BLAST of CX294355 vs. ExPASy Swiss-Prot
Match: HFB2B_ORYSJ (Heat stress transcription factor B-2b OS=Oryza sativa subsp. japonica GN=HSFB2B PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 2.271e-11 Identity = 32/41 (78.05%), Postives = 35/41 (85.37%), Query Frame = 2 Query: 11 SFVRQLNTYGFRKIDPDQWEFANEEFIRGQRHLLKNIHRRK 133 SFVRQLNTYGFRKI PD+WEFAN+ F RG+R LL IHRRK Sbjct: 99 SFVRQLNTYGFRKIVPDRWEFANDCFRRGERRLLCEIHRRK 139
BLAST of CX294355 vs. ExPASy Swiss-Prot
Match: HFB2A_ARATH (Heat stress transcription factor B-2a OS=Arabidopsis thaliana GN=HSFB2A PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 5.060e-11 Identity = 29/48 (60.42%), Postives = 38/48 (79.17%), Query Frame = 2 Query: 11 SFVRQLNTYGFRKIDPDQWEFANEEFIRGQRHLLKNIHRRKPVHSHST 154 SFVRQLNTYGF+K+ PD+WEF+N+ F RG++ LL+ I RRK +H T Sbjct: 74 SFVRQLNTYGFKKVVPDRWEFSNDFFKRGEKRLLREIQRRKITTTHQT 121
BLAST of CX294355 vs. ExPASy Swiss-Prot
Match: HFB4A_ORYSJ (Putative heat stress transcription factor B-4a OS=Oryza sativa subsp. japonica GN=HSFB4A PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 8.631e-11 Identity = 31/53 (58.49%), Postives = 38/53 (71.70%), Query Frame = 2 Query: 11 SFVRQLNTYGFRKIDPDQWEFANEEFIRGQRHLLKNIHRRKPVHSHSTQSPTP 169 SFVRQLNTYGFRK+ P++WEFANE F +G++ LL IHRRK + P P Sbjct: 81 SFVRQLNTYGFRKVVPERWEFANEFFRKGEKQLLCEIHRRKSAAATWPPFPPP 133 The following BLAST results are available for this feature:
BLAST of CX294355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 45
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX294355 ID=CX294355; Name=CX294355; organism=Citrus clementina; type=EST; length=546bpback to top |