CX295556
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX295556 vs. ExPASy Swiss-Prot
Match: CBPA_PSEPW (Curved DNA-binding protein OS=Pseudomonas putida (strain W619) GN=cbpA PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.691e-11 Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 2 Query: 200 DHYKVLGVAQSATLADIKRAYRLLARKYHPDVSKDSRAVEVFKTIRCAYEVLSNEVTRIKYDRALKF 400 D+YK+LGV +A IK AYR LARKYHPDVSK+ A E FK AYEVL + R ++D K+ Sbjct: 5 DYYKILGVEPTADEKAIKAAYRKLARKYHPDVSKERDAEEKFKEANEAYEVLGDAQKRAEFDEIRKY 71
BLAST of CX295556 vs. ExPASy Swiss-Prot
Match: CBPA_PSEPK (Curved DNA-binding protein OS=Pseudomonas putida (strain KT2440) GN=cbpA PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.691e-11 Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 2 Query: 200 DHYKVLGVAQSATLADIKRAYRLLARKYHPDVSKDSRAVEVFKTIRCAYEVLSNEVTRIKYDRALKF 400 D+YK+LGV +A IK AYR LARKYHPDVSK+ A E FK AYEVL + R ++D K+ Sbjct: 5 DYYKILGVEPTADEKAIKAAYRKLARKYHPDVSKERDAEEKFKEANEAYEVLGDAQKRAEFDEIRKY 71
BLAST of CX295556 vs. ExPASy Swiss-Prot
Match: CBPA_PSEP1 (Curved DNA-binding protein OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cbpA PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 8.691e-11 Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 2 Query: 200 DHYKVLGVAQSATLADIKRAYRLLARKYHPDVSKDSRAVEVFKTIRCAYEVLSNEVTRIKYDRALKF 400 D+YK+LGV +A IK AYR LARKYHPDVSK+ A E FK AYEVL + R ++D K+ Sbjct: 5 DYYKILGVEPTADEKAIKAAYRKLARKYHPDVSKERDAEEKFKEANEAYEVLGDAQKRAEFDEIRKY 71 The following BLAST results are available for this feature:
BLAST of CX295556 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 163
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX295556 ID=CX295556; Name=CX295556; organism=Citrus clementina; type=EST; length=715bpback to top |