CX295610
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX295610 vs. ExPASy Swiss-Prot
Match: DXS_BACCN (1-deoxy-D-xylulose-5-phosphate synthase OS=Bacillus cereus subsp. cytotoxis (strain NVH 391-98) GN=dxs PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 8.805e-11 Identity = 29/63 (46.03%), Postives = 47/63 (74.60%), Query Frame = 3 Query: 300 LDTINYPIHMKNLSKEDLEQLAAELRADIVNSVSKTGGHLSANLGVVELTLALHRVFNTPDDK 488 L I P +K++S +LE+L+ ++R ++ +S+TGGH++ NLGVVELT+ALH +F++P DK Sbjct: 3 LTQIQNPSFLKDMSISELEELSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHTLFDSPKDK 65
BLAST of CX295610 vs. ExPASy Swiss-Prot
Match: DXS_BACC4 (1-deoxy-D-xylulose-5-phosphate synthase OS=Bacillus cereus (strain B4264) GN=dxs PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 8.805e-11 Identity = 29/63 (46.03%), Postives = 47/63 (74.60%), Query Frame = 3 Query: 300 LDTINYPIHMKNLSKEDLEQLAAELRADIVNSVSKTGGHLSANLGVVELTLALHRVFNTPDDK 488 L I P +K++S +LE L+ ++R ++ +S+TGGH++ NLGVVELT+ALH++F++P DK Sbjct: 3 LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPQDK 65
BLAST of CX295610 vs. ExPASy Swiss-Prot
Match: DXS_BACC2 (1-deoxy-D-xylulose-5-phosphate synthase OS=Bacillus cereus (strain G9842) GN=dxs PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 8.805e-11 Identity = 29/63 (46.03%), Postives = 47/63 (74.60%), Query Frame = 3 Query: 300 LDTINYPIHMKNLSKEDLEQLAAELRADIVNSVSKTGGHLSANLGVVELTLALHRVFNTPDDK 488 L I P +K++S +LE L+ ++R ++ +S+TGGH++ NLGVVELT+ALH++F++P DK Sbjct: 3 LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPQDK 65 The following BLAST results are available for this feature:
BLAST of CX295610 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 303
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX295610 ID=CX295610; Name=CX295610; organism=Citrus clementina; type=EST; length=493bpback to top |