CX296597
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_CERCA (Ubiquitin OS=Ceratitis capitata PE=1 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 5.058e-15 Identity = 36/55 (65.45%), Postives = 46/55 (83.64%), Query Frame = 1 Query: 13 GKTLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 GKT+TL+VE SDT++N +A QDKEGIPPDQQ +IFAG +ED RTL+DYN++ E Sbjct: 10 GKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_CAVPO (Ubiquitin OS=Cavia porcellus GN=RPS27A PE=3 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 5.058e-15 Identity = 36/55 (65.45%), Postives = 46/55 (83.64%), Query Frame = 1 Query: 13 GKTLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 GKT+TL+VE SDT++N +A QDKEGIPPDQQ +IFAG +ED RTL+DYN++ E Sbjct: 10 GKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_CANFA (Ubiquitin OS=Canis familiaris GN=UBA52 PE=3 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 5.058e-15 Identity = 36/55 (65.45%), Postives = 46/55 (83.64%), Query Frame = 1 Query: 13 GKTLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 GKT+TL+VE SDT++N +A QDKEGIPPDQQ +IFAG +ED RTL+DYN++ E Sbjct: 10 GKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_CAMDR (Ubiquitin OS=Camelus dromedarius PE=3 SV=2) HSP 1 Score: 79.7221 bits (195), Expect = 5.058e-15 Identity = 36/55 (65.45%), Postives = 46/55 (83.64%), Query Frame = 1 Query: 13 GKTLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 GKT+TL+VE SDT++N +A QDKEGIPPDQQ +IFAG +ED RTL+DYN++ E Sbjct: 10 GKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_BOVIN (Ubiquitin OS=Bos taurus GN=RPS27A PE=1 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 5.058e-15 Identity = 36/55 (65.45%), Postives = 46/55 (83.64%), Query Frame = 1 Query: 13 GKTLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 GKT+TL+VE SDT++N +A QDKEGIPPDQQ +IFAG +ED RTL+DYN++ E Sbjct: 10 GKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_PHYIN (Ubiquitin OS=Phytophthora infestans PE=1 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.606e-15 Identity = 36/55 (65.45%), Postives = 45/55 (81.82%), Query Frame = 1 Query: 13 GKTLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 GKT+TLDVE SD++DN + QDKEGIPPDQQ +IFAG +ED RTL+DYN++ E Sbjct: 10 GKTITLDVEPSDSIDNVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_TRYBB (Ubiquitin OS=Trypanosoma brucei brucei PE=3 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.472e-14 Identity = 35/55 (63.64%), Postives = 46/55 (83.64%), Query Frame = 1 Query: 13 GKTLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 GKT+ L+VE+SDT++N +A QDKEGIPPDQQ +IFAG +E+ RTLADYN++ E Sbjct: 10 GKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKE 64
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_STRPU (Ubiquitin OS=Strongylocentrotus purpuratus PE=3 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.472e-14 Identity = 35/55 (63.64%), Postives = 46/55 (83.64%), Query Frame = 1 Query: 13 GKTLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 GKT+TL+VE SD+++N +A QDKEGIPPDQQ +IFAG +ED RTL+DYN++ E Sbjct: 10 GKTITLEVEPSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_ENCCU (Ubiquitin OS=Encephalitozoon cuniculi GN=ECU02_0740i PE=1 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.472e-14 Identity = 35/55 (63.64%), Postives = 46/55 (83.64%), Query Frame = 1 Query: 13 GKTLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 GKT+TL+VE SD+++N +A QDKEGIPPDQQ +IFAG +ED RTL+DYN++ E Sbjct: 10 GKTITLEVEPSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
BLAST of CX296597 vs. ExPASy Swiss-Prot
Match: UBIQ_DICDI (Ubiquitin OS=Dictyostelium discoideum GN=ubqA PE=1 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.472e-14 Identity = 35/55 (63.64%), Postives = 45/55 (81.82%), Query Frame = 1 Query: 13 GKTLTLDVESSDTLDNEEAPTQDKEGIPPDQQMVIFAGHDVEDVRTLADYNLENE 177 GKT+TL+VE SD ++N +A QDKEGIPPDQQ +IFAG +ED RTL+DYN++ E Sbjct: 10 GKTITLEVEGSDNIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64 The following BLAST results are available for this feature:
BLAST of CX296597 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 73
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX296597 ID=CX296597; Name=CX296597; organism=Citrus clementina; type=EST; length=406bpback to top |