CX297681
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX297681 vs. ExPASy Swiss-Prot
Match: DNJA4_MOUSE (DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 9.743e-11 Identity = 31/64 (48.44%), Postives = 43/64 (67.19%), Query Frame = 2 Query: 245 FYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYD 436 +YD+LG+ S +P EIK+AY+ L LKYHPD +P E ++F + +AYE LSDP R +YD Sbjct: 7 YYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDE-----GEKFKLISQAYEVLSDPKKRDIYD 65
BLAST of CX297681 vs. ExPASy Swiss-Prot
Match: DNAJ_PROMH (Chaperone protein dnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 9.743e-11 Identity = 31/70 (44.29%), Postives = 47/70 (67.14%), Query Frame = 2 Query: 233 ATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYDNH 442 A FY++LG+ ++ +EIK+AYK L +KYHPD + ++ E+ +F ++EAYE LSDP RA YD + Sbjct: 2 AKRDFYEVLGLSKTADEKEIKRAYKRLAMKYHPDRNQGDKDSES--KFKEIKEAYEVLSDPQKRAAYDQY 69
BLAST of CX297681 vs. ExPASy Swiss-Prot
Match: DNAJ_CALS8 (Chaperone protein dnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 9.743e-11 Identity = 30/69 (43.48%), Postives = 45/69 (65.22%), Query Frame = 2 Query: 230 AATESFYDLLGIPQSVTPREIKQAYKHLVLKYHPDVSPPERIDENTKRFIRLQEAYETLSDPNTRALYD 436 A + +Y++LG+P++ T EIK+AY+ L +YHPD +P + E ++F + EAYE LSDP R YD Sbjct: 2 AQKKDYYEILGVPRNATQEEIKRAYRRLAKQYHPDANPGNK--EAEEKFKEINEAYEVLSDPEKRRKYD 68 The following BLAST results are available for this feature:
BLAST of CX297681 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 23
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX297681 ID=CX297681; Name=CX297681; organism=Citrus clementina; type=EST; length=760bpback to top |