CX297705
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX297705 vs. ExPASy Swiss-Prot
Match: RL32P_MOUSE (Putative 60S ribosomal protein L32' OS=Mus musculus GN=Rpl32-ps PE=5 SV=2) HSP 1 Score: 69.707 bits (169), Expect = 1.822e-11 Identity = 30/44 (68.18%), Postives = 38/44 (86.36%), Query Frame = 1 Query: 577 RPQSDRKISVKENWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKK 708 R QSDR + +K NWR+P+GID+RVRR+FKG +LMPNIGY S+KK Sbjct: 22 RHQSDRYVKIKWNWRKPRGIDNRVRRRFKGQILMPNIGYRSNKK 65
BLAST of CX297705 vs. ExPASy Swiss-Prot
Match: RL32_ICTPU (60S ribosomal protein L32 OS=Ictalurus punctatus GN=rpl32 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 3.108e-11 Identity = 30/50 (60.00%), Postives = 39/50 (78.00%), Query Frame = 1 Query: 577 RPQSDRKISVKENWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKHATICP 726 R QSDR + ++ NWR+P+GID+RVR FKG +LMPNIGYGS+KK + P Sbjct: 22 RHQSDRYVKIRRNWRKPRGIDNRVRSGFKGQMLMPNIGYGSNKKTKHMLP 71 The following BLAST results are available for this feature:
BLAST of CX297705 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX297705 ID=CX297705; Name=CX297705; organism=Citrus clementina; type=EST; length=729bpback to top |