CX298067
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX298067 vs. ExPASy Swiss-Prot
Match: ALAT1_MOUSE (Alanine aminotransferase 1 OS=Mus musculus GN=Gpt PE=2 SV=3) HSP 1 Score: 71.633 bits (174), Expect = 1.366e-12 Identity = 31/60 (51.67%), Postives = 42/60 (70.00%), Query Frame = 1 Query: 7 DVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 186 D+F+CL LLE TGI VPGSGFGQ+EG +H R TILP E + ++E + F+ +F +Y Sbjct: 436 DMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFHAKFTHEY 495
BLAST of CX298067 vs. ExPASy Swiss-Prot
Match: ALAT1_RAT (Alanine aminotransferase 1 OS=Rattus norvegicus GN=Gpt PE=1 SV=2) HSP 1 Score: 70.4774 bits (171), Expect = 3.042e-12 Identity = 31/60 (51.67%), Postives = 41/60 (68.33%), Query Frame = 1 Query: 7 DVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 186 D+F+CL LLE TGI VPGSGFGQ+EG +H R TILP E + ++E F+ +F +Y Sbjct: 436 DMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRLLLEKLSHFHAKFTHEY 495
BLAST of CX298067 vs. ExPASy Swiss-Prot
Match: ALAM_YEAST (Probable alanine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae GN=ALT1 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.510e-11 Identity = 35/62 (56.45%), Postives = 41/62 (66.13%), Query Frame = 1 Query: 7 DVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYED 192 D FYC +LLE+TGI TVPGSGFGQ+ G +HLRTT L + ESF K EF +QY D Sbjct: 534 DEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHK---EFFDQYRD 592 The following BLAST results are available for this feature:
BLAST of CX298067 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX298067 ID=CX298067; Name=CX298067; organism=Citrus clementina; type=EST; length=361bpback to top |