CX298078
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX298078 vs. ExPASy Swiss-Prot
Match: UBC4_YEAST (Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae GN=UBC4 PE=1 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 2.329e-12 Identity = 30/38 (78.95%), Postives = 35/38 (92.11%), Query Frame = 3 Query: 6 LTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 119 LTD NPDDPLVPEIAH+YK+D+ KYEATAR WT+KYA+ Sbjct: 111 LTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYAV 148
BLAST of CX298078 vs. ExPASy Swiss-Prot
Match: UBC4_SCHPO (Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe GN=ubc4 PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.973e-12 Identity = 28/38 (73.68%), Postives = 36/38 (94.74%), Query Frame = 3 Query: 6 LTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 119 LTDPNPDDPLVPEIAH+YK+D+++YE +AR WT+KYA+ Sbjct: 110 LTDPNPDDPLVPEIAHVYKTDRSRYELSAREWTRKYAI 147
BLAST of CX298078 vs. ExPASy Swiss-Prot
Match: UBC1_MAGGR (Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnaporthe grisea GN=UBC1 PE=3 SV=2) HSP 1 Score: 70.0922 bits (170), Expect = 3.973e-12 Identity = 29/38 (76.32%), Postives = 36/38 (94.74%), Query Frame = 3 Query: 6 LTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 119 LTDPNPDDPLVPEIAH+YK+ +A+YE+TAR WT+KYA+ Sbjct: 110 LTDPNPDDPLVPEIAHVYKTARAQYESTAREWTRKYAI 147
BLAST of CX298078 vs. ExPASy Swiss-Prot
Match: UBC5_YEAST (Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae GN=UBC5 PE=1 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.190e-12 Identity = 30/38 (78.95%), Postives = 35/38 (92.11%), Query Frame = 3 Query: 6 LTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 119 LTD NPDDPLVPEIA +YK+DKAKYEATA+ WT+KYA+ Sbjct: 111 LTDANPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYAV 148
BLAST of CX298078 vs. ExPASy Swiss-Prot
Match: UBC4_CANAL (Ubiquitin-conjugating enzyme E2 4 OS=Candida albicans GN=UBC4 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.778e-12 Identity = 29/38 (76.32%), Postives = 34/38 (89.47%), Query Frame = 3 Query: 6 LTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 119 LTD NPDDPLVPEIAH+YK D+ KYEATA+ WT+KYA+ Sbjct: 110 LTDANPDDPLVPEIAHIYKQDRKKYEATAKEWTKKYAV 147
BLAST of CX298078 vs. ExPASy Swiss-Prot
Match: UB2D4_HUMAN (Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens GN=UBE2D4 PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.972e-11 Identity = 29/38 (76.32%), Postives = 31/38 (81.58%), Query Frame = 3 Query: 6 LTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 119 L DPNPDDPLVPEIAH YK+D+ KY AR WTQKYAM Sbjct: 110 LCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM 147
BLAST of CX298078 vs. ExPASy Swiss-Prot
Match: U2D2B_RAT (Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus GN=Ube2d2b PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.576e-11 Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 3 Query: 6 LTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 119 L DPNPDDPLVPEIA +YK+D+ KY TAR WTQKYAM Sbjct: 110 LCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYAM 147
BLAST of CX298078 vs. ExPASy Swiss-Prot
Match: U2D2B_MOUSE (Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculus GN=Ube2d2b PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.576e-11 Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 3 Query: 6 LTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 119 L DPNPDDPLVPEIA +YK+D+ KY TAR WTQKYAM Sbjct: 110 LCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYAM 147
BLAST of CX298078 vs. ExPASy Swiss-Prot
Match: UB2D1_MOUSE (Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus GN=Ube2d1 PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.738e-11 Identity = 29/38 (76.32%), Postives = 31/38 (81.58%), Query Frame = 3 Query: 6 LTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 119 L DPNPDDPLVP+IA +YKSDK KY AR WTQKYAM Sbjct: 110 LCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147
BLAST of CX298078 vs. ExPASy Swiss-Prot
Match: UB2D1_HUMAN (Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens GN=UBE2D1 PE=1 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.738e-11 Identity = 29/38 (76.32%), Postives = 31/38 (81.58%), Query Frame = 3 Query: 6 LTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 119 L DPNPDDPLVP+IA +YKSDK KY AR WTQKYAM Sbjct: 110 LCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147 The following BLAST results are available for this feature:
BLAST of CX298078 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 26
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX298078 ID=CX298078; Name=CX298078; organism=Citrus clementina; type=EST; length=363bpback to top |