CX299902
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOB1_SCHPO (Maintenance of ploidy protein mob1 OS=Schizosaccharomyces pombe GN=mob1 PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 9.684e-12 Identity = 29/53 (54.72%), Postives = 42/53 (79.25%), Query Frame = 1 Query: 1 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSII 159 AHIY SHF +V+++ E++LNT FKHF+ F EFGL+D KE P+Q+L+DS++ Sbjct: 158 AHIYCSHFHVMVAMELESYLNTSFKHFVFFCREFGLMDNKEYAPMQDLVDSMV 210
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOB1C_DICDI (Mps one binder kinase activator-like 1 homolog C OS=Dictyostelium discoideum GN=mobC PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.652e-11 Identity = 31/52 (59.62%), Postives = 38/52 (73.08%), Query Frame = 1 Query: 1 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSI 156 AHIY+SH ++ L EAHLNT F+HF LF EF L+DKKE+ PLQ +ID I Sbjct: 159 AHIYYSHMDRVSVLGVEAHLNTAFRHFYLFIKEFNLVDKKEMLPLQNIIDKI 210
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOL2A_BOVIN (Mps one binder kinase activator-like 2A OS=Bos taurus GN=MOBKL2A PE=2 SV=2) HSP 1 Score: 66.2402 bits (160), Expect = 8.198e-11 Identity = 28/47 (59.57%), Postives = 34/47 (72.34%), Query Frame = 1 Query: 4 HIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQEL 144 H+Y HF +I L EAH+NTC+KHF F EFGLID KEL PL+E+ Sbjct: 165 HVYIHHFDRIAQLGSEAHVNTCYKHFYYFVTEFGLIDTKELEPLKEM 211 The following BLAST results are available for this feature:
BLAST of CX299902 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX299902 ID=CX299902; Name=CX299902; organism=Citrus clementina; type=EST; length=474bpback to top |