CX299908
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_GEOBB (ATP-dependent Clp protease proteolytic subunit OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=clpP PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.893e-11 Identity = 32/71 (45.07%), Postives = 46/71 (64.79%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 IMI QP+G +GQATD+ I KE+ +K +L L A+H G++ E++ AD R + S EA YGIID ++ Sbjct: 119 IMIHQPLGGFQGQATDIHIHAKEILRMKDQLNALLAEHTGQSVEKVAADTERDYFMSGEEAKNYGIIDAIV 189
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_EHRCR (ATP-dependent Clp protease proteolytic subunit OS=Ehrlichia chaffeensis (strain Arkansas) GN=clpP PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.893e-11 Identity = 30/71 (42.25%), Postives = 46/71 (64.79%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 IMI QP G +GQATD+EI KE+ ++K L +Y KH G+ ++ A++ R + +A ++GIIDKV+ Sbjct: 120 IMIHQPSGGFQGQATDIEIHAKEILDIKGRLNDIYVKHTGRDLSEVVANMERDNFMRAEKAKDFGIIDKVI 190
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_EHRCJ (ATP-dependent Clp protease proteolytic subunit OS=Ehrlichia canis (strain Jake) GN=clpP PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.893e-11 Identity = 30/71 (42.25%), Postives = 47/71 (66.20%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 IMI QP G +GQATD+EI KE+ ++K+ L +Y KH G+ ++ A++ R + +A ++GIIDKV+ Sbjct: 120 IMIHQPSGGFQGQATDIEIHAKEILDIKSRLNDIYVKHTGRDLPEVVANMERDNFMRAEKAKDFGIIDKVI 190
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_CLOPS (ATP-dependent Clp protease proteolytic subunit OS=Clostridium perfringens (strain SM101 / Type A) GN=clpP PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.893e-11 Identity = 30/71 (42.25%), Postives = 49/71 (69.01%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 IMI QP+G +GQATD++I K + +K +L ++ +++ + E+I+ D+ R + SEAVEYG+IDKV+ Sbjct: 121 IMIHQPLGGFQGQATDIDIHAKRILKIKDKLNQILSENTNQPLEKIKVDVERDYFMEASEAVEYGLIDKVI 191
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_CLOPE (ATP-dependent Clp protease proteolytic subunit OS=Clostridium perfringens GN=clpP PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.893e-11 Identity = 30/71 (42.25%), Postives = 49/71 (69.01%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 IMI QP+G +GQATD++I K + +K +L ++ +++ + E+I+ D+ R + SEAVEYG+IDKV+ Sbjct: 121 IMIHQPLGGFQGQATDIDIHAKRILKIKDKLNQILSENTNQPLEKIKVDVERDYFMEASEAVEYGLIDKVI 191
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_CLOP1 (ATP-dependent Clp protease proteolytic subunit OS=Clostridium perfringens (strain ATCC 13124 / NCTC 8237 / Type A) GN=clpP PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.893e-11 Identity = 30/71 (42.25%), Postives = 49/71 (69.01%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 IMI QP+G +GQATD++I K + +K +L ++ +++ + E+I+ D+ R + SEAVEYG+IDKV+ Sbjct: 121 IMIHQPLGGFQGQATDIDIHAKRILKIKDKLNQILSENTNQPLEKIKVDVERDYFMEASEAVEYGLIDKVI 191
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP3_SYNP6 (ATP-dependent Clp protease proteolytic subunit 3 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=clpP3 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.893e-11 Identity = 34/71 (47.89%), Postives = 46/71 (64.79%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 IMI QP+G +GQA D+EI +E+ K+ L L A+H G+ E+IE D R + SP EA YG+ID+VL Sbjct: 154 IMIHQPLGGAQGQAVDIEIQAREILYHKSTLNDLLAQHTGQPLEKIEVDTDRDFFMSPEEAKAYGLIDQVL 224
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP2_SYNE7 (ATP-dependent Clp protease proteolytic subunit 2 OS=Synechococcus elongatus (strain PCC 7942) GN=clpP2 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.893e-11 Identity = 34/71 (47.89%), Postives = 46/71 (64.79%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 IMI QP+G +GQA D+EI +E+ K+ L L A+H G+ E+IE D R + SP EA YG+ID+VL Sbjct: 154 IMIHQPLGGAQGQAVDIEIQAREILYHKSTLNDLLAQHTGQPLEKIEVDTDRDFFMSPEEAKAYGLIDQVL 224
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP1_PROMM (ATP-dependent Clp protease proteolytic subunit 1 OS=Prochlorococcus marinus (strain MIT 9313) GN=clpP1 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.893e-11 Identity = 33/71 (46.48%), Postives = 47/71 (66.20%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 IMI QP+G +GQA D+EI KE+ +K L L A+H G+ +I D R + SP++AVEYG+ID+V+ Sbjct: 142 IMIHQPLGGAQGQAVDIEIQAKEILFLKETLNGLLAEHTGQPLNKIAEDTDRDHFLSPAKAVEYGLIDRVV 212 The following BLAST results are available for this feature:
BLAST of CX299908 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 169
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX299908 ID=CX299908; Name=CX299908; organism=Citrus clementina; type=EST; length=378bpback to top |