CX299908
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_SALCH (ATP-dependent Clp protease proteolytic subunit OS=Salmonella choleraesuis GN=clpP PE=3 SV=2) HSP 1 Score: 73.9442 bits (180), Expect = 2.782e-13 Identity = 34/71 (47.89%), Postives = 49/71 (69.01%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 +MI QP+G +GQATD+EI +E+ VK + +L A H G++ EQIE D R ++ S EAVEYG++D +L Sbjct: 133 VMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSIL 203
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_BAUCH (ATP-dependent Clp protease proteolytic subunit OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=clpP PE=3 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 2.782e-13 Identity = 34/71 (47.89%), Postives = 50/71 (70.42%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 +MI QP+G +GQATD++I KE+ VK + +L AKH GKT + IE D R ++ S +EAV+YG++D +L Sbjct: 131 MMIHQPMGGFQGQATDIQIHAKEILKVKNRMNELMAKHIGKTLQVIEQDTERDRFLSANEAVDYGLVDAIL 201
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_AQUAE (ATP-dependent Clp protease proteolytic subunit OS=Aquifex aeolicus GN=clpP PE=3 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 2.782e-13 Identity = 35/71 (49.30%), Postives = 50/71 (70.42%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 IMI QP+G I+GQATD+ I +E+K +K L+ + AKH G+ ++I DI R + SP EA +YG+IDKV+ Sbjct: 127 IMIHQPLGGIQGQATDIIIHAEEIKRIKEMLIDILAKHTGQPKDKIANDIERDYFMSPYEAKDYGLIDKVI 197
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_SHISS (ATP-dependent Clp protease proteolytic subunit OS=Shigella sonnei (strain Ss046) GN=clpP PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.633e-13 Identity = 34/71 (47.89%), Postives = 49/71 (69.01%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 +MI QP+G +GQATD+EI +E+ VK + +L A H G++ EQIE D R ++ S EAVEYG++D +L Sbjct: 133 VMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSIL 203
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_SHIFL (ATP-dependent Clp protease proteolytic subunit OS=Shigella flexneri GN=clpP PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.633e-13 Identity = 34/71 (47.89%), Postives = 49/71 (69.01%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 +MI QP+G +GQATD+EI +E+ VK + +L A H G++ EQIE D R ++ S EAVEYG++D +L Sbjct: 133 VMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSIL 203
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_SHIF8 (ATP-dependent Clp protease proteolytic subunit OS=Shigella flexneri serotype 5b (strain 8401) GN=clpP PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.633e-13 Identity = 34/71 (47.89%), Postives = 49/71 (69.01%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 +MI QP+G +GQATD+EI +E+ VK + +L A H G++ EQIE D R ++ S EAVEYG++D +L Sbjct: 133 VMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSIL 203
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_SHIDS (ATP-dependent Clp protease proteolytic subunit OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=clpP PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.633e-13 Identity = 34/71 (47.89%), Postives = 49/71 (69.01%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 +MI QP+G +GQATD+EI +E+ VK + +L A H G++ EQIE D R ++ S EAVEYG++D +L Sbjct: 133 VMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSIL 203
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_SHIBS (ATP-dependent Clp protease proteolytic subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=clpP PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.633e-13 Identity = 34/71 (47.89%), Postives = 49/71 (69.01%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 +MI QP+G +GQATD+EI +E+ VK + +L A H G++ EQIE D R ++ S EAVEYG++D +L Sbjct: 133 VMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSIL 203
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_PHOLL (ATP-dependent Clp protease proteolytic subunit OS=Photorhabdus luminescens subsp. laumondii GN=clpP PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.633e-13 Identity = 33/70 (47.14%), Postives = 49/70 (70.00%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKV 213 +MI QP+G +GQATD+EI +E+ VK+ + +L AKH G+ E+I D R ++ S EAVEYG++DK+ Sbjct: 133 VMIHQPLGGFQGQATDIEIHAQEILKVKSRMNELMAKHTGRPIEEIAKDTERDRFLSADEAVEYGLVDKI 202
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_ECOUT (ATP-dependent Clp protease proteolytic subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=clpP PE=3 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.633e-13 Identity = 34/71 (47.89%), Postives = 49/71 (69.01%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 +MI QP+G +GQATD+EI +E+ VK + +L A H G++ EQIE D R ++ S EAVEYG++D +L Sbjct: 133 VMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSIL 203 The following BLAST results are available for this feature:
BLAST of CX299908 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 169
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX299908 ID=CX299908; Name=CX299908; organism=Citrus clementina; type=EST; length=378bpback to top |