CX299908
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP4_PROM9 (ATP-dependent Clp protease proteolytic subunit 4 OS=Prochlorococcus marinus (strain MIT 9312) GN=clpP4 PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.380e-12 Identity = 36/71 (50.70%), Postives = 48/71 (67.61%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 IMI QP+G +GQA ++EI KE+ +K L L A+H G+ E+I D R + SPSEAVEYG+IDKV+ Sbjct: 147 IMIHQPLGGAQGQAVEIEIQAKEILFLKKTLNSLLAEHTGQPLEKINEDTERDYFLSPSEAVEYGLIDKVI 217
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_AZOSB (ATP-dependent Clp protease proteolytic subunit OS=Azoarcus sp. (strain BH72) GN=clpP PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.803e-12 Identity = 34/71 (47.89%), Postives = 49/71 (69.01%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 +MI QP+G +GQA+D+EI +E+ ++ L + AKH G+T EQIE D R + S + AVEYG++DKVL Sbjct: 136 VMIHQPLGGFQGQASDIEIHAREILYLRERLNGMLAKHTGQTIEQIEKDTDRDNFMSATAAVEYGLVDKVL 206
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_WIGBR (ATP-dependent Clp protease proteolytic subunit OS=Wigglesworthia glossinidia brevipalpis GN=clpP PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 2.355e-12 Identity = 35/75 (46.67%), Postives = 50/75 (66.67%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEK 228 IMI QP+G +GQATD+ I E+ +K +++L +KH G++ E I D R ++FS SEAV YG+IDKV+ K Sbjct: 120 IMIHQPLGGSQGQATDIAIHTTEILKIKKCMIELLSKHTGQSAEIISKDTERDRFFSGSEAVIYGLIDKVITCRK 194
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_ALCBS (ATP-dependent Clp protease proteolytic subunit OS=Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) GN=clpP PE=3 SV=2) HSP 1 Score: 70.8626 bits (172), Expect = 2.355e-12 Identity = 35/71 (49.30%), Postives = 46/71 (64.79%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 +MI QP+G +GQA+D+EI KE+ +K +L L A H G+ EQ+E D R + S EA EYGIID VL Sbjct: 130 VMIHQPLGGFQGQASDIEIHAKEILKIKGQLNSLLAHHTGQPIEQLEKDTDRDNFMSADEAKEYGIIDAVL 200
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_MAGSM (ATP-dependent Clp protease proteolytic subunit OS=Magnetococcus sp. (strain MC-1) GN=clpP PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.075e-12 Identity = 32/78 (41.03%), Postives = 50/78 (64.10%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEKSPE 237 +MI QP+G GQA+D EI +E+ ++ L ++ + H GK EQ++ D R + S +EAVEYG++DKV+ + PE Sbjct: 120 VMIHQPLGGFSGQASDFEIHAREILRIRENLNQVLSHHTGKPLEQVQLDTERDNFLSATEAVEYGLVDKVISHRELPE 197
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP2_MYXXA (ATP-dependent Clp protease proteolytic subunit 2 OS=Myxococcus xanthus GN=clpP2 PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.075e-12 Identity = 34/70 (48.57%), Postives = 48/70 (68.57%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKV 213 IMI QP+G + GQATD+EI KE+ +KA+L +L KH G++ E++E D R + SEA YGIID++ Sbjct: 122 IMIHQPLGGVRGQATDIEIQAKEILRMKAKLNELIVKHTGQSIERVEKDTDRDYFMGASEAKAYGIIDEI 191
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP1_MYXXD (ATP-dependent Clp protease proteolytic subunit 1 OS=Myxococcus xanthus (strain DK 1622) GN=clpP1 PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.075e-12 Identity = 34/70 (48.57%), Postives = 48/70 (68.57%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKV 213 IMI QP+G + GQATD+EI KE+ +KA+L +L KH G++ E++E D R + SEA YGIID++ Sbjct: 122 IMIHQPLGGVRGQATDIEIQAKEILRMKAKLNELIVKHTGQSIERVEKDTDRDYFMGASEAKAYGIIDEI 191
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_PSEPW (ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas putida (strain W619) GN=clpP PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 4.017e-12 Identity = 34/70 (48.57%), Postives = 46/70 (65.71%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKV 213 +MI QP+G +GQATD+EI +E+ N+KA L +L A H G+ E I+ D R + S S A EYG+ID V Sbjct: 136 VMIHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAAEYGLIDSV 205
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_PSEPK (ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas putida (strain KT2440) GN=clpP PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 4.017e-12 Identity = 34/70 (48.57%), Postives = 46/70 (65.71%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKV 213 +MI QP+G +GQATD+EI +E+ N+KA L +L A H G+ E I+ D R + S S A EYG+ID V Sbjct: 136 VMIHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAAEYGLIDSV 205
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_PSEP1 (ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=clpP PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 4.017e-12 Identity = 34/70 (48.57%), Postives = 46/70 (65.71%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKV 213 +MI QP+G +GQATD+EI +E+ N+KA L +L A H G+ E I+ D R + S S A EYG+ID V Sbjct: 136 VMIHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAAEYGLIDSV 205 The following BLAST results are available for this feature:
BLAST of CX299908 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 169
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX299908 ID=CX299908; Name=CX299908; organism=Citrus clementina; type=EST; length=378bpback to top |