CX299908
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_THIDA (ATP-dependent Clp protease proteolytic subunit OS=Thiobacillus denitrificans (strain ATCC 25259) GN=clpP PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.526e-11 Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 +MI QP+G +GQA+D+EI KE+ +KA L + AKH G++ E I+ D R + S ++V+YG++DKVL Sbjct: 134 VMIHQPLGGFQGQASDIEIHAKEILYLKARLNGMLAKHTGQSLEVIDRDTDRDNFMSAEDSVKYGLVDKVL 204
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_LEPIN (ATP-dependent Clp protease proteolytic subunit OS=Leptospira interrogans GN=clpP PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.526e-11 Identity = 34/75 (45.33%), Postives = 47/75 (62.67%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEK 228 IM+ QP+G GQA+D+EI +E+ +K L +Y KH GKT EQI+ D R Y + EA YGIID V+ ++ Sbjct: 120 IMMHQPMGGATGQASDIEIQAREVLKLKEILNSIYHKHTGKTVEQIQKDTERNFYMTADEAKNYGIIDTVIQIDR 194
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_GEOSF (ATP-dependent Clp protease proteolytic subunit OS=Geobacter sp. (strain FRC-32) GN=clpP PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.526e-11 Identity = 33/71 (46.48%), Postives = 48/71 (67.61%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 IMI QP+G +GQATD+ I +E+ +K +L +L A+H G+T E+IEAD R + S +A YGIID ++ Sbjct: 119 IMIHQPLGGFQGQATDIHIHAQEILRMKKKLNELLAEHSGQTVEKIEADTERDYFMSGEDAKTYGIIDSII 189
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_CHLCH (ATP-dependent Clp protease proteolytic subunit OS=Chlorobium chlorochromatii (strain CaD3) GN=clpP PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.526e-11 Identity = 31/78 (39.74%), Postives = 49/78 (62.82%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEKSPE 237 IMI QP G +GQ TD+ I +E++ ++ L +L AKH G+ E++ D R ++ +P EA+EYG+ID + +PE Sbjct: 145 IMIHQPSGGAQGQETDIVIQAREIEKIRRLLEELLAKHTGQPVEKVREDSERDRWMNPQEALEYGLIDAIFEKRPTPE 222
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP1_LEPIC (ATP-dependent Clp protease proteolytic subunit 1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni GN=clpP1 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.526e-11 Identity = 34/75 (45.33%), Postives = 47/75 (62.67%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEK 228 IM+ QP+G GQA+D+EI +E+ +K L +Y KH GKT EQI+ D R Y + EA YGIID V+ ++ Sbjct: 120 IMMHQPMGGATGQASDIEIQAREVLKLKEILNSIYHKHTGKTVEQIQKDTERNFYMTADEAKNYGIIDTVIQIDR 194
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_THICR (ATP-dependent Clp protease proteolytic subunit OS=Thiomicrospira crunogena (strain XCL-2) GN=clpP PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.993e-11 Identity = 33/71 (46.48%), Postives = 46/71 (64.79%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 216 +MI QP+G +GQA+D+EI KE+ +K +L K A H G+ E IE D R + S EA +YG++DKVL Sbjct: 127 VMIHQPLGGFQGQASDIEIHAKEIIQIKQKLNKALADHTGQPIEVIENDTDRDNFMSADEACDYGLVDKVL 197
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_THESQ (ATP-dependent Clp protease proteolytic subunit OS=Thermotoga sp. (strain RQ2) GN=clpP PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.993e-11 Identity = 35/75 (46.67%), Postives = 48/75 (64.00%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEK 228 IMI QP+G EG A DVEI +E+ +K L ++ +KH G+ E+IE D R + S EA EYGI+DKV+ T + Sbjct: 129 IMIHQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSAEEAKEYGIVDKVVSTRE 203
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_THEP1 (ATP-dependent Clp protease proteolytic subunit OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=clpP PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.993e-11 Identity = 35/75 (46.67%), Postives = 48/75 (64.00%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEK 228 IMI QP+G EG A DVEI +E+ +K L ++ +KH G+ E+IE D R + S EA EYGI+DKV+ T + Sbjct: 129 IMIHQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSAEEAKEYGIVDKVVSTRE 203
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_THEMA (ATP-dependent Clp protease proteolytic subunit OS=Thermotoga maritima GN=clpP PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.993e-11 Identity = 35/75 (46.67%), Postives = 48/75 (64.00%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEK 228 IMI QP+G EG A DVEI +E+ +K L ++ +KH G+ E+IE D R + S EA EYGI+DKV+ T + Sbjct: 129 IMIHQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSAEEAKEYGIVDKVVSTRE 203
BLAST of CX299908 vs. ExPASy Swiss-Prot
Match: CLPP_RHOPT (ATP-dependent Clp protease proteolytic subunit OS=Rhodopseudomonas palustris (strain TIE-1) GN=clpP PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.993e-11 Identity = 34/79 (43.04%), Postives = 51/79 (64.56%), Query Frame = 1 Query: 4 IMIKQPIGRIEGQATDVEIARKEMKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEKSPED 240 IM+ QP G +GQATD+ + +E+ N+K L ++Y H G+T + IE + R K+ + A E+GI+DKV+ EK PED Sbjct: 128 IMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERDKFLTAEMAREFGIVDKVI--EKRPED 204 The following BLAST results are available for this feature:
BLAST of CX299908 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 169
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX299908 ID=CX299908; Name=CX299908; organism=Citrus clementina; type=EST; length=378bpback to top |