CX305587
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_STACT (Chaperone protein dnaJ OS=Staphylococcus carnosus (strain TM300) GN=dnaJ PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 7.102e-11 Identity = 32/64 (50.00%), Postives = 44/64 (68.75%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YE+LG+ A+ EIK AYRKL++ HPD+ +Q E + KF ++ EAYE LSD KRA+YD+ Sbjct: 7 YEVLGVSKDASKDEIKKAYRKLSKKYHPDI---NQEEGAEEKFKEISEAYEVLSDENKRANYDQ 67
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_ENTFA (Chaperone protein dnaJ OS=Enterococcus faecalis GN=dnaJ PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 7.102e-11 Identity = 32/64 (50.00%), Postives = 45/64 (70.31%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YE+LG+ GA+ EIK AYRKL++ HPD+ ++ E KF ++ EAYE LSDP+K+A YD+ Sbjct: 8 YEVLGLAKGASDDEIKKAYRKLSKKYHPDINKEADAEE---KFKEVSEAYEVLSDPQKKAAYDQ 68
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_CLONN (Chaperone protein dnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 7.102e-11 Identity = 32/64 (50.00%), Postives = 44/64 (68.75%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YE+LG+ GA+ EIK AYRKLA HPD N+ + KF ++EAY+ LSDP+K+A+YD+ Sbjct: 7 YEVLGLSKGASDDEIKKAYRKLAMKYHPD--RNQGNKEAEEKFKDINEAYQVLSDPQKKANYDQ 68
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNJB5_HUMAN (DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 9.275e-11 Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 Y+ILGI +GA EIK AYRK+A HPD K++ N+ KF ++ EAY+ LSDPKKR YD+ Sbjct: 6 YKILGIPSGANEDEIKKAYRKMALKYHPD---KNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQ 66
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNJB5_BOVIN (DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 9.275e-11 Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 Y+ILGI +GA EIK AYRK+A HPD K++ N+ KF ++ EAY+ LSDPKKR YD+ Sbjct: 6 YKILGIPSGANEDEIKKAYRKMALKYHPD---KNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQ 66
BLAST of CX305587 vs. ExPASy Swiss-Prot
Match: DNAJ_CLOAB (Chaperone protein dnaJ OS=Clostridium acetobutylicum GN=dnaJ PE=2 SV=2) HSP 1 Score: 65.855 bits (159), Expect = 9.275e-11 Identity = 32/64 (50.00%), Postives = 45/64 (70.31%), Query Frame = 3 Query: 255 YEILGIQAGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 446 YE+LG++ GA+ EIK A+RKLA HPD N+ + KF +++EAY+ LSDP K+A+YDR Sbjct: 7 YEVLGLEKGASDDEIKKAFRKLAIKYHPD--KNRGNKEAEEKFKEINEAYQVLSDPDKKANYDR 68 The following BLAST results are available for this feature:
BLAST of CX305587 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 56
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX305587 ID=CX305587; Name=CX305587; organism=Citrus clementina; type=EST; length=452bpback to top |