CX306043
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX306043 vs. ExPASy Swiss-Prot
Match: PR4_PRUPE (Pathogenesis-related protein PR-4 (Fragment) OS=Prunus persica PE=2 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 3.484e-16 Identity = 33/49 (67.35%), Postives = 37/49 (75.51%), Query Frame = 3 Query: 156 EQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGTC 302 + I WDL AS FCATWDA+KPL+WR KYGWTAFC GP GQ +CG C Sbjct: 1 QNINWDLRTASVFCATWDADKPLSWRSKYGWTAFCGPVGPTGQDSCGKC 49
BLAST of CX306043 vs. ExPASy Swiss-Prot
Match: CHAL_BRARA (Chitin-binding allergen Bra r 2 (Fragments) OS=Brassica rapa PE=1 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 2.761e-13 Identity = 30/47 (63.83%), Postives = 35/47 (74.47%), Query Frame = 3 Query: 135 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGP 275 TYH Y+P Q WDL A SA+C+TWDA+KP +WR YGWTAFC GP Sbjct: 35 TYHYYNPAQNNWDLRAVSAYCSTWDADKPYSWR--YGWTAFCGPAGP 79 The following BLAST results are available for this feature:
BLAST of CX306043 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX306043 ID=CX306043; Name=CX306043; organism=Citrus clementina; type=EST; length=302bpback to top |