CX306388
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX306388 vs. ExPASy Swiss-Prot
Match: THIO_MYCSM (Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 6.169e-11 Identity = 32/80 (40.00%), Postives = 53/80 (66.25%), Query Frame = -3 Query: 218 IAAKKLIVVDFTASWCPPCKLMSPILSELAKKLP---AVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK 448 + + K ++VDF A+WC PCK+++P+L E+A + V + VDVD + A ++ V ++PT +L K+G ++RIVGAK Sbjct: 20 LGSSKPVLVDFWATWCGPCKMVAPVLEEIAAEKGDQLTVAKIDVDVDANPATARDFQVVSIPTMILFKDGAPVKRIVGAK 99
BLAST of CX306388 vs. ExPASy Swiss-Prot
Match: THIO1_DROYA (Thioredoxin-1 OS=Drosophila yakuba GN=dhd PE=2 SV=2) HSP 1 Score: 66.6254 bits (161), Expect = 8.057e-11 Identity = 35/97 (36.08%), Postives = 57/97 (58.76%), Query Frame = -3 Query: 206 SCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDEL 493 S T+ ++++++ A KLIV+DF A+WC PCK M + LA+K + LK+DVD+ + + E + V +MPTFV + + L GA + +L Sbjct: 3 SVRTMTDFHKRIEA--ADDKLIVLDFYANWCGPCKDMESTVKSLARKYSTKAVVLKIDVDKFEELTERYKVRSMPTFVFLRNNRRLAAFSGADEHKL 97 The following BLAST results are available for this feature:
BLAST of CX306388 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 102
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX306388 ID=CX306388; Name=CX306388; organism=Citrus clementina; type=EST; length=528bpback to top |