CX306388
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX306388 vs. ExPASy Swiss-Prot
Match: THIO_STAAR (Thioredoxin OS=Staphylococcus aureus (strain MRSA252) GN=trxA PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 2.769e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = -3 Query: 185 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEKH 427 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX306388 vs. ExPASy Swiss-Prot
Match: THIO_STAAN (Thioredoxin OS=Staphylococcus aureus (strain N315) GN=trxA PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 2.769e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = -3 Query: 185 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEKH 427 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX306388 vs. ExPASy Swiss-Prot
Match: THIO_STAAM (Thioredoxin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxA PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 2.769e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = -3 Query: 185 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEKH 427 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX306388 vs. ExPASy Swiss-Prot
Match: THIO_STAAC (Thioredoxin OS=Staphylococcus aureus (strain COL) GN=trxA PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 2.769e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = -3 Query: 185 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEKH 427 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX306388 vs. ExPASy Swiss-Prot
Match: THIO_STAAB (Thioredoxin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trxA PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 2.769e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = -3 Query: 185 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEKH 427 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX306388 vs. ExPASy Swiss-Prot
Match: THIO_STAA8 (Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 2.769e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = -3 Query: 185 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEKH 427 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX306388 vs. ExPASy Swiss-Prot
Match: THIO_STAA3 (Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 2.769e-11 Identity = 33/83 (39.76%), Postives = 56/83 (67.47%), Query Frame = -3 Query: 185 VVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEKH 427 +VDF A+WC PCK+++P+L ELA LK+DVDE S A ++ V ++PT ++ K+G+ ++++VG + K+ L ++KH Sbjct: 21 LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH 103
BLAST of CX306388 vs. ExPASy Swiss-Prot
Match: THIOM_BOVIN (Thioredoxin, mitochondrial OS=Bos taurus GN=TXN2 PE=1 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 2.769e-11 Identity = 34/83 (40.96%), Postives = 55/83 (66.27%), Query Frame = -3 Query: 188 IVVDFTASWCPPCKLMSPILSEL-AKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK-KDELQLAVEK 430 +VVDF A WC PCK++ P L ++ AK+ V+ KVD+D+ +A E+ V A+PT + K G V+++ VG K +D+L+ ++K Sbjct: 81 VVVDFHAQWCGPCKILGPRLEKVVAKQHGKVVMAKVDIDDHTDLALEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKK 163
BLAST of CX306388 vs. ExPASy Swiss-Prot
Match: THIO_CHLLT (Thioredoxin OS=Chlorobium limicola f.sp. thiosulfatophilum GN=trxA PE=1 SV=5) HSP 1 Score: 67.3958 bits (163), Expect = 4.723e-11 Identity = 30/86 (34.88%), Postives = 57/86 (66.28%), Query Frame = -3 Query: 185 KLIVVDFTASWCPPCKLMSPILSELAKKLPA-VIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGA-KKDELQLAVEKH 436 K ++VDF ASWC PC ++ P++ +LA I K++VDE ++A ++ + ++PT ++ K GKV++++VGA K+ + +++H Sbjct: 21 KAVLVDFWASWCGPCMMLGPVIEQLADDYEGKAIIAKLNVDENPNIAGQYGIRSIPTMLIIKGGKVVDQMVGALPKNMIAKKIDEH 106
BLAST of CX306388 vs. ExPASy Swiss-Prot
Match: TRXB_MYCLE (Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae GN=trxB/A PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 6.169e-11 Identity = 31/78 (39.74%), Postives = 55/78 (70.51%), Query Frame = -3 Query: 218 IAAKKLIVVDFTASWCPPCKLMSPILSELA-KKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAK 448 +++ K ++VDF A+WC PCK+++P+L E+A ++ + K+DVD +A E+ V ++PT +L + G+ ++RIVGAK Sbjct: 364 LSSNKPVLVDFWATWCGPCKMVAPVLEEIASEQRNQLTVAKLDVDTNPEMAREFQVVSIPTMILFQGGQPVKRIVGAK 441 The following BLAST results are available for this feature:
BLAST of CX306388 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 102
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX306388 ID=CX306388; Name=CX306388; organism=Citrus clementina; type=EST; length=528bpback to top |