CX308892
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX308892 vs. ExPASy Swiss-Prot
Match: ZEAM_MAIZE (Zeamatin OS=Zea mays GN=Zlp PE=1 SV=2) HSP 1 Score: 85.1149 bits (209), Expect = 3.210e-16 Identity = 35/52 (67.31%), Postives = 42/52 (80.77%), Query Frame = 1 Query: 1 CC---NSGNCGPTGFSKFFKDRCPDVYSYPKDDATSTFTCPTGTDYKVVFCP 147 CC + +C PT +S++FK +CPD YSYPKDDATSTFTCP GT+YKVVFCP Sbjct: 176 CCVGSAANDCHPTNYSRYFKGQCPDAYSYPKDDATSTFTCPAGTNYKVVFCP 227
BLAST of CX308892 vs. ExPASy Swiss-Prot
Match: OS35_SOLCO (Osmotin-like protein OSML15 OS=Solanum commersonii PE=2 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 5.476e-16 Identity = 36/52 (69.23%), Postives = 40/52 (76.92%), Query Frame = 1 Query: 1 CCNSGNCGPTGFSKFFKDRCPDVYSYPKDDATSTFTCPT-GTDYKVVFCP*G 153 CC G CGPT S+FFK RCPD YSYP+DD TSTFTC + TDYKV+FCP G Sbjct: 178 CCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCQSWTTDYKVMFCPYG 229
BLAST of CX308892 vs. ExPASy Swiss-Prot
Match: PRR2_TOBAC (Pathogenesis-related protein R minor form OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 1.593e-15 Identity = 34/51 (66.67%), Postives = 40/51 (78.43%), Query Frame = 1 Query: 1 CCNSG--NCGPTGFSKFFKDRCPDVYSYPKDDATSTFTCPTGTDYKVVFCP 147 CC +G +CGPT S+FFK RCPD YSYP+DD S FTCP GT+Y+VVFCP Sbjct: 176 CCTNGPGSCGPTDLSRFFKARCPDAYSYPQDDPPSLFTCPPGTNYRVVFCP 226
BLAST of CX308892 vs. ExPASy Swiss-Prot
Match: OLPA_TOBAC (Osmotin-like protein OS=Nicotiana tabacum GN=OLPA PE=1 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 2.718e-15 Identity = 35/52 (67.31%), Postives = 40/52 (76.92%), Query Frame = 1 Query: 1 CCNSGNCGPTGFSKFFKDRCPDVYSYPKDDATSTFTCPT-GTDYKVVFCP*G 153 CC G CGPT S++FK RCPD YSYP+DD TSTFTC + TDYKV+FCP G Sbjct: 178 CCTQGPCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYKVMFCPYG 229
BLAST of CX308892 vs. ExPASy Swiss-Prot
Match: OSL3_ARATH (Osmotin-like protein OSM34 OS=Arabidopsis thaliana GN=OSM34 PE=2 SV=2) HSP 1 Score: 76.2554 bits (186), Expect = 1.491e-13 Identity = 33/51 (64.71%), Postives = 40/51 (78.43%), Query Frame = 1 Query: 1 CCNSG--NCGPTGFSKFFKDRCPDVYSYPKDDATSTFTCPTGTDYKVVFCP 147 CC +G +C T +S+FFK RCPD YSYP+DD TSTFTC T T+Y+VVFCP Sbjct: 174 CCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTC-TNTNYRVVFCP 223
BLAST of CX308892 vs. ExPASy Swiss-Prot
Match: PRR3_JUNAS (Pathogenesis-related protein OS=Juniperus ashei PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 5.304e-11 Identity = 29/52 (55.77%), Postives = 36/52 (69.23%), Query Frame = 1 Query: 1 CCNSG---NCGPTGFSKFFKDRCPDVYSYPKDDATSTFTCPTGTDYKVVFCP 147 CC + NC T +SK FK++CP YSY KDD T+TF C +GTDY +VFCP Sbjct: 175 CCRNAYVDNCPATNYSKIFKNQCPQAYSYAKDD-TATFACASGTDYSIVFCP 225 The following BLAST results are available for this feature:
BLAST of CX308892 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 26
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX308892 ID=CX308892; Name=CX308892; organism=Citrus clementina; type=EST; length=632bpback to top |