CX309040
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: OS35_SOLCO (Osmotin-like protein OSML15 OS=Solanum commersonii PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.647e-15 Identity = 34/50 (68.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 1 CCNSGNCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPT-GTDYKVVFCP 147 CC G CGPT S+FFK R PD YSYP+DD TSTFTC + TDYKV+FCP Sbjct: 178 CCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCQSWTTDYKVMFCP 227
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: PRR2_TOBAC (Pathogenesis-related protein R minor form OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.475e-14 Identity = 33/51 (64.71%), Postives = 39/51 (76.47%), Query Frame = 1 Query: 1 CCNSG--NCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPTGTDYKVVFCP 147 CC +G +CGPT S+FFK R PD YSYP+DD S FTCP GT+Y+VVFCP Sbjct: 176 CCTNGPGSCGPTDLSRFFKARCPDAYSYPQDDPPSLFTCPPGTNYRVVFCP 226
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: OLPA_TOBAC (Osmotin-like protein OS=Nicotiana tabacum GN=OLPA PE=1 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.291e-14 Identity = 33/50 (66.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 1 CCNSGNCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPT-GTDYKVVFCP 147 CC G CGPT S++FK R PD YSYP+DD TSTFTC + TDYKV+FCP Sbjct: 178 CCTQGPCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYKVMFCP 227
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: OSL3_ARATH (Osmotin-like protein OSM34 OS=Arabidopsis thaliana GN=OSM34 PE=2 SV=2) HSP 1 Score: 71.633 bits (174), Expect = 1.380e-12 Identity = 32/51 (62.75%), Postives = 39/51 (76.47%), Query Frame = 1 Query: 1 CCNSG--NCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPTGTDYKVVFCP 147 CC +G +C T +S+FFK R PD YSYP+DD TSTFTC T T+Y+VVFCP Sbjct: 174 CCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTC-TNTNYRVVFCP 223 The following BLAST results are available for this feature:
BLAST of CX309040 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 14
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX309040 ID=CX309040; Name=CX309040; organism=Citrus clementina; type=EST; length=378bpback to top |