DY258757
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DY258757 vs. ExPASy Swiss-Prot
Match: CIRBP_XENTR (Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 4.637e-11 Identity = 34/76 (44.74%), Postives = 52/76 (68.42%), Query Frame = 3 Query: 165 RVYVGNLSWGVDDLALETLFREQGKVLEAKVVYDRESGRSRGFGFVTYSSAEEVDNAIDSLNGVDLAGRAIRVSVA 392 +++VG L++ + +LE +F + G+V E VV DRES RSRGFGFVT+ + E+ +A+ ++NG + GR IRV A Sbjct: 7 KLFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKSVDGRQIRVDQA 82
BLAST of DY258757 vs. ExPASy Swiss-Prot
Match: CIRBP_PONAB (Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 6.056e-11 Identity = 32/76 (42.11%), Postives = 53/76 (69.74%), Query Frame = 3 Query: 165 RVYVGNLSWGVDDLALETLFREQGKVLEAKVVYDRESGRSRGFGFVTYSSAEEVDNAIDSLNGVDLAGRAIRVSVA 392 +++VG LS+ ++ +LE +F + G++ E VV DRE+ RSRGFGFVT+ + ++ +A+ ++NG + GR IRV A Sbjct: 7 KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQA 82
BLAST of DY258757 vs. ExPASy Swiss-Prot
Match: CIRBP_HUMAN (Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 6.056e-11 Identity = 32/76 (42.11%), Postives = 53/76 (69.74%), Query Frame = 3 Query: 165 RVYVGNLSWGVDDLALETLFREQGKVLEAKVVYDRESGRSRGFGFVTYSSAEEVDNAIDSLNGVDLAGRAIRVSVA 392 +++VG LS+ ++ +LE +F + G++ E VV DRE+ RSRGFGFVT+ + ++ +A+ ++NG + GR IRV A Sbjct: 7 KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQA 82 The following BLAST results are available for this feature:
BLAST of DY258757 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 33
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY258757 ID=DY258757; Name=DY258757; organism=Citrus clementina; type=EST; length=791bpback to top |