DY258810
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY258810 vs. ExPASy Swiss-Prot
Match: ATPA_LEMMI (ATP synthase subunit alpha, chloroplastic OS=Lemna minor GN=atpA PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 6.297e-11 Identity = 34/45 (75.56%), Postives = 40/45 (88.89%), Query Frame = 3 Query: 3 DSLYIGQVRKFLVELRTYLKTNKPQFREIISSTKIFTE*SKALLR 137 DSL +GQVRKFLV+LRTYLK NKPQF+EIISSTK FT ++ALL+ Sbjct: 447 DSLEVGQVRKFLVQLRTYLKKNKPQFQEIISSTKTFTPEAEALLK 491
BLAST of DY258810 vs. ExPASy Swiss-Prot
Match: ATPA_PIPCE (ATP synthase subunit alpha, chloroplastic OS=Piper cenocladum GN=atpA PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 8.224e-11 Identity = 33/45 (73.33%), Postives = 41/45 (91.11%), Query Frame = 3 Query: 3 DSLYIGQVRKFLVELRTYLKTNKPQFREIISSTKIFTE*SKALLR 137 D L GQV+KFLV+LRTYLKTNKPQF+EIISSTKIFT+ ++A+L+ Sbjct: 447 DPLETGQVKKFLVQLRTYLKTNKPQFQEIISSTKIFTKDAEAILK 491
BLAST of DY258810 vs. ExPASy Swiss-Prot
Match: ATPA_LIRTU (ATP synthase subunit alpha, chloroplastic OS=Liriodendron tulipifera GN=atpA PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 8.224e-11 Identity = 34/45 (75.56%), Postives = 40/45 (88.89%), Query Frame = 3 Query: 3 DSLYIGQVRKFLVELRTYLKTNKPQFREIISSTKIFTE*SKALLR 137 D L IGQV+KFLV+LRTYLKTNKPQ +EIISSTK FTE ++ALL+ Sbjct: 447 DPLEIGQVKKFLVQLRTYLKTNKPQLQEIISSTKTFTEQAEALLK 491
BLAST of DY258810 vs. ExPASy Swiss-Prot
Match: ATPA_DRIGR (ATP synthase subunit alpha, chloroplastic OS=Drimys granadensis GN=atpA PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 8.224e-11 Identity = 34/45 (75.56%), Postives = 41/45 (91.11%), Query Frame = 3 Query: 3 DSLYIGQVRKFLVELRTYLKTNKPQFREIISSTKIFTE*SKALLR 137 D L IGQV+KFLV+LRT+LKTNKPQF+EIISSTK FTE ++ALL+ Sbjct: 447 DPLDIGQVKKFLVQLRTHLKTNKPQFQEIISSTKTFTEQAEALLK 491
BLAST of DY258810 vs. ExPASy Swiss-Prot
Match: ATPA_COFAR (ATP synthase subunit alpha, chloroplastic OS=Coffea arabica GN=atpA PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 8.224e-11 Identity = 34/45 (75.56%), Postives = 40/45 (88.89%), Query Frame = 3 Query: 3 DSLYIGQVRKFLVELRTYLKTNKPQFREIISSTKIFTE*SKALLR 137 DSL IGQVRKFLV LR Y+KTNKPQF+EIISSTK FTE +++LL+ Sbjct: 447 DSLEIGQVRKFLVALRAYVKTNKPQFQEIISSTKTFTEEAESLLK 491 The following BLAST results are available for this feature:
BLAST of DY258810 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 35
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY258810 ID=DY258810; Name=DY258810; organism=Citrus clementina; type=EST; length=1160bpback to top |